PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ48256.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 519aa    MW: 53717.5 Da    PI: 5.9116
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ48256.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP911.3e-28415491177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +C vegC a l  +++y++rhk Ce+h+ka +v+ +g+ +rfCqqC+r   l+efD +krsCr  L +h  rr ++ 
  KXZ48256.1 415 ICTVEGCGASLLGLRSYYQRHKTCEFHAKADTVMKDGRPHRFCQQCGRLQPLTEFDGAKRSCRATLLRHCMRRAQQM 491
                 5************************************************************************8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546955.41E-1436142IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.103.4E-1638144No hitNo description
PfamPF006511.1E-1241142IPR000210BTB/POZ domain
SMARTSM002251.8E-749146IPR000210BTB/POZ domain
PROSITE profilePS500979.84849109IPR000210BTB/POZ domain
Gene3DG3DSA:4.10.1100.104.1E-27409477IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.649413490IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-25415489IPR004333Transcription factor, SBP-box
PfamPF031101.6E-26416488IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MGRLTGLRLE SSREEQGREE GAPTFHLDLD LIQLISEGKK KFFDNPALSD ITLLCPDGRT  60
IYCHSVILAA ASQRFADVLT PGSWVPGQQL PVEGVDSDAL FTLIRAFYTC PCPVELERVP  120
ALYDAAIKLE VGSLASALEQ FVGSALSADA AVPLLQRCLG LGVDALADVV LGWIRDRAAD  180
VLPSPEFRTC PLEAAALICK TLAQRNQMLA LQSLRGGDGG GADAKVEELL GSAGPAGFSL  240
GALAGVGDPE PSRLPSRAQI ISALRMARQL GAGPLPNVSP VQEHGTGPGG PLALPPAASL  300
APGPGVASAG LGPSDDRPAE EWHMRPNPSQ EEQGDVDYQA GAAAAYGRSP LLDGGGSGSG  360
GFAGADDRVS GGTANTGVTR SGGGGDNSGG AGSRPETSQP SSLTATGRQS IARGICTVEG  420
CGASLLGLRS YYQRHKTCEF HAKADTVMKD GRPHRFCQQC GRLQPLTEFD GAKRSCRATL  480
LRHCMRRAQQ MQAGAGEAAP PQLVGRGGQA GTTAAFDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-174154871082squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001694726.19e-63predicted protein, partial
TrEMBLA0A150GEK10.0A0A150GEK1_GONPE; Uncharacterized protein
STRINGEDP023104e-62(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.18e-21squamosa promoter binding protein-like 3