PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ47614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 849aa    MW: 82833 Da    PI: 6.4513
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ47614.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP93.61.9e-29568645178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +C+vegC a l  +++y++r+k+Ce+h k ++vl  g+ +rfCqqC+rf  +sefD ekrsCr  L++h +rr k+++
  KXZ47614.1 568 TCHVEGCGASLVGLRDYYQRYKICEFHLKVNSVLKGGVPHRFCQQCGRFQPVSEFDGEKRSCRVMLQRHCNRRAKQKQ 645
                 6************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546953.22E-1317113IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.107.4E-1718115No hitNo description
PfamPF006511.0E-1318115IPR000210BTB/POZ domain
PROSITE profilePS5009712.0612087IPR000210BTB/POZ domain
SMARTSM002256.5E-1020117IPR000210BTB/POZ domain
Gene3DG3DSA:4.10.1100.102.0E-27563630IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.085566643IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.11E-26568646IPR004333Transcription factor, SBP-box
PfamPF031104.3E-27569642IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MPVLQLDSRG AAEAPPRELS DLTLLCPDGR AIHCHSVILA AASRRFASVF KQAGWTPGQQ  60
MPVKGVDSDA LETLVRAFYT SECPLDLDRI PAIYDAAVKL EVPSLAPSLE QFVSTALTAE  120
SALGFLQRCL GLGLGALADA ALEWIRSRVA EVVPSPEFRS CQLDTAALVC KNLAQRSQLV  180
GLQAAVSWLS ALPSRAALLL PFAELTGLDP EAIHAVAASG ATLNNVTAAL GLTDGGAGGR  240
QHGLPHGLTQ SLVASLGLDL TGHGGSGGFG GPPLVPSLDL GMQPGGMGGS GGHGGGGGMG  300
PLGTDQQSLL GLGGGLGLGL APGGGPGDGG GGVVPVLQLL APMGRDMRQQ MLLMPPGVEG  360
GAAVGLQSLL MQQHGAGGND GKPGGKAGGV GLGMGFGLDA LAEAAQDAEQ AAARRGGKAG  420
PGGGGGLGVE RSGSAASTTS DMSGEGQNHA RPLPGGGGRA AGAVGGGRRK RPASASDEDE  480
DYEPGASGGG VGRGGGSRAR TQAAYEQMAP SFDGMGGGGA AGAQDDMNSG GGGGSGGGGD  540
AGGGGGALTE SSPPVLMTGR RQPAVKGTCH VEGCGASLVG LRDYYQRYKI CEFHLKVNSV  600
LKGGVPHRFC QQCGRFQPVS EFDGEKRSCR VMLQRHCNRR AKQKQELAEV LAQRLGEKQL  660
QYLTSLPADG PGSESDGGGG GGSGRSGGRA GGRGGSRSGL PPGLSSPPSK QALMEAVARQ  720
QALAQQQLLG LGLANEGTLA AVVSALAAAN EAGGDGAGGR GALGGPLSGA LGGALGLAGL  780
TGGPKGGPSV ELDKAVAEAT AAAAAGPQPA LGGGAVAALL ALPAAGAGSG TDAVGSGGDA  840
GGGVATKAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-175696421184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1415423GGKAGPGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GCP80.0A0A150GCP8_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.15e-20squamosa promoter binding protein-like 9