PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ45840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 360aa    MW: 38886.1 Da    PI: 8.0212
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ45840.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP77.42.2e-243651375
                T--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
         SBP 13 eakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                  k y+rr+ vC +h +a + lv+g++qrfCqqC++f ++ +fD+ krsCr++La+h  rrr 
  KXZ45840.1  3 MEKAYYRRYNVCATHLRALELLVDGRMQRFCQQCGKFQDVADFDDIKRSCREQLARHSLRRRI 65
                5699********************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114120.751166IPR004333Transcription factor, SBP-box
PfamPF031103.3E-23364IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-19453IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-20466IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MRMEKAYYRR YNVCATHLRA LELLVDGRMQ RFCQQCGKFQ DVADFDDIKR SCREQLARHS  60
LRRRIKLSQR RRQEMGGIAD GDDSNSDMDD AAGAVRPAAT KSSAAEPALA RQARQEVRKA  120
VTAPILDLEG GLAGVPLVGE PMESAGPVLQ RLSLKLYGCS PEELMPDTRN RLQAWLGSMN  180
LAMFDLAVRR GCAHLVADVL TAAAPSRVHL PSHAGHQALG FAHPYTGSTE RSGFHCTVSA  240
LSQRDEAFES PEEGGSNSSG GSSSVMHDLP TGAGEVVSPL GSDDEASAMA WLLGGTRACT  300
ANAGRFPLSA LLQQLLGPRL GRPSTEYTEP AGGRLVMQLD SKVQRPVWLQ GAPPWRASPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-151642083squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150G9060.0A0A150G906_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-15squamosa promoter binding protein-like 4