PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ45710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family bZIP
Protein Properties Length: 395aa    MW: 40134.4 Da    PI: 6.5268
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ45710.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-101902391160
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                 +kNR+A+rr+RqR k++++ Le+++++L+ + ++L  e e+l+++   l+
  KXZ45710.1 190 EKNRSAQRRFRQRQKEKMAYLENRSEVLSVQVEKLSTECESLRNMNTMLE 239
                 69*******************************************98665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0017165244IPR004827Basic-leucine zipper domain
CDDcd146881.91E-10190245No hitNo description
SuperFamilySSF579592.44E-9190242No hitNo description
PfamPF001702.7E-8190239IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.3E-10190242No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGDDDALESF LDSYLTSSFG ATGNSGYGMG QQQQQQPQQM LQAQTQQQLL GMSGGQPLGG  60
PMTAPAPVLR PASDSLLVNQ RSAMGLPGGM QVPGQSQAAP AGLAGHGLSG LRTNSLSAQT  120
AVALGQQAGS AHGCGGAAGS SKKGGLFESV QPPPVAEGSG DDSSEDESSQ QRRRGKGRTT  180
STANHHPTSE KNRSAQRRFR QRQKEKMAYL ENRSEVLSVQ VEKLSTECES LRNMNTMLEK  240
VLNLREEHIS NLQEAAKVFS SLNIRESEGG SGTAADQGAK AMQDAVTAAA AASGGDGSMS  300
AVVKSEDGMA MGGGMAGSGG GGSGMTEQGI AGAGAGLLAG GGGHVLPTNI SGATARFTAE  360
AIRAMSADDV VEAWKENLKE LSRRVKAGGA GRGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002951098.11e-76hypothetical protein VOLCADRAFT_91555
TrEMBLA0A150G8M10.0A0A150G8M1_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP190466