PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ44247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 1130aa    MW: 117094 Da    PI: 6.3746
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ44247.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP107.96.6e-3490166177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +CqvegC +dls  k y++r++vCe h k  + +v+g+  rfCqqC+rf el+efD +krsCr rL +hn+rrrk+ 
  KXZ44247.1  90 VCQVEGCGHDLSVEKGYYQRYRVCEPHMKLLSLVVNGKPSRFCQQCGRFQELTEFDGSKRSCRARLLQHNARRRKRD 166
                 6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-3085152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.5388165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-2989167IPR004333Transcription factor, SBP-box
PfamPF031101.2E-3091164IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.32E-5862984IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-4866984IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.8902984IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1130 aa     Download sequence    Send to blast
MADVFNAAFS AEPHAQWPAG RFAWDPSQLH ALPSPESGSS GDPFLEAGHR DQSLGPVPIG  60
WDEAPSNSPG PAPGAGKETK ASRAPKGPLV CQVEGCGHDL SVEKGYYQRY RVCEPHMKLL  120
SLVVNGKPSR FCQQCGRFQE LTEFDGSKRS CRARLLQHNA RRRKRDPYDT CRKEQTNRKS  180
KSAHPWSGSS DDAEPASRGS VDVSHGVDKA VASYGMDGAV DQGISVHSLG PKVSSSSAAP  240
AWQGGLGSMG VMPMDVPTTA PLPQSILQPL SGQPLSGQPV SGQPLSAGQP LPGQHQSAMA  300
NKGYVRWQAA SAESLDPLDD VLDSILGTEM DYLDDPGVPV PSRATEARDR LASAGVTVNP  360
AFLPGACLGG LAAQPAPQTA DQMWMGSMTS SPAQSGVVLN SNNSFTSGVP VSGPWQQGVG  420
GGVAGLDLAA QQRLKQQRIL QQQQMMAQQQ QMAATARPSI NSGLSIMDTY MGVVSSSTAG  480
GLAGPVSGQG YGPRSSWASA NPSGTPELMS GSGVFGGSGD VGMSQATASA AASPFPAAPR  540
PGAQSSFDLA RRLVASGGAA AQYKGEDLMV RVSIKIANCT PDQLPPDLYQ RLRNLCSAAD  600
ATVLVQTHDE VSLWPAGAPA SAAPQHSVRI ADLESAHSLP TIAYVSPAVH VDGTGCASLY  660
VFGTGLARAG VEFFARMQGG YVPVEVQQLA AGGVALPSLA EDTDFGKTAA AALRHVEALK  720
SAGRSAEDVI MIRVRGTPGT GLLLLEAQAG PLLSNWRPCL LSTNAAIAAE LSGWGLAALR  780
RGAAAMDSLE SFIIDFGRVL DKRSYERPVP PPAVLTSTAV SKTIHEEESD NEEENGDEVF  840
ADAVSGSIEG EGGVTLELVC VCERLLGWAA DAGLARVSTF LMSALLQYGQ SAQAILEAPY  900
ADGLSVLHRC ARSGNPTAVA ALANWAASCG VHAEWGGIGA LGVSPLHLAA LLPRTWAALS  960
MLPEARAFWA ISRATADGAS PVHLQRALLR VLPRDAAAHG LAELFAAPKP RAVVRPPVAK  1020
HVEASPLSVS SRHVNQDAPL LSVAPDKASG GFAMAPLLAS VLAATLAAAL LAPRALQMPA  1080
SDAPDAVIRT EFVGIALLLL SVAGFFLPGK MSAAMLLSQV HPASTCIPTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2281164184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150G3170.0A0A150G317_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-25SBP family protein