PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ43590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family bZIP
Protein Properties Length: 372aa    MW: 38950.4 Da    PI: 9.3418
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ43590.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.21.5e-07320365550
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                 ++e+ +++NR+A+rr+R+R ++ i  L++kv+e ea  ++L+k+l 
  KXZ43590.1 320 RKEMCRERNRTAQRRFRERQRELIRVLQDKVDEQEALIRSLRKRLA 365
                 68899*************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.9E-5320365No hitNo description
SuperFamilySSF579592.88E-5325365No hitNo description
PROSITE patternPS000360325338IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MSSDLTASAC AAALAGYQAP SRRRYHAVQV TKYAFGDPRT SDSSGVSNSH STENSLVAPV  60
PNTSTLCPPG DEHVESLLNS LMAIPPRRPA PPGPAGAQAM ARKLQRGASG TGLVGNGGGS  120
LHAHEGLLPE AVGRVAALAA PGSLEAAAAM ASVGQAHELV QGGSQGPPGT TAGMASIGGI  180
PHYRANHAAI LKTAPAILTT RPPFHPASHG LSSFSGGNSP VTVAEHYRAQ LGASADLPTA  240
AAAAAAAQAG THTTSLSGSE DEGKDEPATY VEQGRTAMKQ DYLDEDATTD SEEEAQRRRA  300
RKRAASQRGR VSKAAAANER KEMCRERNRT AQRRFRERQR ELIRVLQDKV DEQEALIRSL  360
RKRLAIYEPP VE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150G2Q20.0A0A150G2Q2_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1239833