PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ43584.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 260aa    MW: 27247 Da    PI: 8.869
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ43584.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP552.1e-1730105176
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                 +Cqv++C+ +ls++ e ++   +C+ h  a++v++ g+ qrfCqqC+++  l+ef+ ++++Cr+r +   +rr++ 
  KXZ43584.1  30 VCQVDNCKRQLSSCSEEQKCLLICDSHYGAAEVTHGGTLQRFCQQCGHMQPLEEFEAGQHACRSRCQLAARRRKRG 105
                 6****************************************************************99998888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-162792IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.45228105IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-1430105IPR004333Transcription factor, SBP-box
PfamPF031101.1E-1731104IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MIKNLSPVRQ AAAPIPANNF SNAATAPRCV CQVDNCKRQL SSCSEEQKCL LICDSHYGAA  60
EVTHGGTLQR FCQQCGHMQP LEEFEAGQHA CRSRCQLAAR RRKRGRKEGE DFAVDEGEAA  120
VAAASTQDAP GGVPPKPLRK VASAGGANPL YAASAQQQRN RDRVTRRLTD DTGETTSSSM  180
CSGGGGPTTA GGACALSAPV PVPVMQHRYV AATGAPPSAF LLLRRALAAA VEVQVWMAVR  240
TPVPARKPCA LAPAVALAFA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100107RRKRGRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150G1790.0A0A150G179_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.18e-15squamosa promoter binding protein-like 1