PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ41787.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 842aa    MW: 82805.7 Da    PI: 7.4441
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ41787.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP85.85.2e-27752823273
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                 C+vegC a l+ +++y++rh  Ce h+ka +vl +g+ +rfCqqC+rf  lsefD +krsCr  L++h +r 
  KXZ41787.1 752 CHVEGCGASLAGLRNYYQRHNTCEYHAKADSVLKEGRPHRFCQQCGRFQPLSEFDGDKRSCRVMLQRHYDRH 823
                 ******************************************************************999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546951.96E-1229138IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.101.9E-1532140No hitNo description
PfamPF006516.3E-1239138IPR000210BTB/POZ domain
PROSITE profilePS500979.33145112IPR000210BTB/POZ domain
SMARTSM002259.9E-645142IPR000210BTB/POZ domain
PROSITE profilePS5114123.623749826IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-24751823IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.0E-27751813IPR004333Transcription factor, SBP-box
PfamPF031105.0E-26752823IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MAAFQAERRG LNALAGEDAS LQLNSQLHKL ILAGKRVFFN NPTLSDISIV CPDGRQISCH  60
SVILKSASRR LAAVLEQGSW VAGQKLPVQG VDSEALFALV RYFYTDECPA ELEQMPALYD  120
AAVKLEVGSL ASVLEQFVGS ALSADAAVPL LQRCLGLGVD ALADVVLGWI RDRAMDVLRT  180
SGYRTCPLEA AALICKTLAQ RNQLLALRAA VTWLSAVPSR ASMVIPFVEL SGLDPEAILE  240
VAATGVKLDG PAPAAQQQQQ HAAAPQPPTL LDLAAAAATA EAAPPKQQQL QAPKLLLKLE  300
PPAEPLLSAA AVGSGQQQGD VARMAAALGL GGLGVRGLGG GAGGGLAALG LAPLGLGGLG  360
LDGDLGLLAG SQGAGGGLGG LGGLLGSMGG GLGAAAQQAL PPQRRSSTAA DRGLNGTSLA  420
PGLGMGMGLG LEGLGGVAAG IGGGLGGGRL GLIGSLDGGG LGGGLGGGLG LGQGLGSLLR  480
GLPDGLQQGS GLLLSKLEGA GNTAVSGGGG GGGFNSLLPL QLQLLAGGGG GTAAGGGGGG  540
GLLLTDSAGL GGLGLGLGSL MGGTGSGDAA ATMAAAAALR GLAGSGAAPD LLIQSGGGSG  600
AGSGGSGTAH GGAGAGEAAE WSGSAASTTS GMPGGAQRPD QNAAGPSGGG GVGRRKRQSG  660
TRGPKGDEED DEDYVPKRRA GGGGGAAAGQ RMARPMTSAG PSPLRGEVLP STAGTPAGDE  720
AGGGGPPGGR GDDAAPALPV LVTTWRYPKG HCHVEGCGAS LAGLRNYYQR HNTCEYHAKA  780
DSVLKEGRPH RFCQQCGRFQ PLSEFDGDKR SCRVMLQRHY DRHCSRRSKQ LALQKQLAGQ  840
DD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-177528221181squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150FW260.0A0A150FW26_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-18squamosa promoter binding protein-like 8