PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ41683.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 1218aa    MW: 122038 Da    PI: 6.7913
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ41683.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.91.8e-35726802177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +C+v++C++dl+++keyh+r+++C++h ka+vv+ +g+ qrfCqqC+rfh lsefD +krsCr rL +hn+rrrk++
  KXZ41683.1 726 MCHVDDCQVDLASLKEYHQRFRICDFHLKAEVVMREGIPQRFCQQCGRFHVLSEFDGAKRSCRARLMRHNARRRKRA 802
                 6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.710.101.0E-91192No hitNo description
PfamPF006512.9E-81291IPR000210BTB/POZ domain
SuperFamilySSF546951.73E-71291IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:4.10.1100.101.4E-30721788IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.06724801IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-31725802IPR004333Transcription factor, SBP-box
PfamPF031105.1E-30727800IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1218 aa     Download sequence    Send to blast
MNTPVEAALA AAVVLASCSR KFASVLAQGD ATGKELPIQG VDSEALESVV RFFYCGECLL  60
STATVVPIHD VCLKLEVPGL GAGCEAYVQQ SLNPATCMTY LGAAVRLLLE PTIKLCLSYA  120
TSRFEDVIAA PGFQSLSPEA VRLLLTHMRG GASDISLARA LARWAVRKPE HLPDCEAMFQ  180
ELNITATALL QLLQLPDFVQ ALQHGPGLGG RLGPAGEAAA AAAALGPLER LLGGAAAGGL  240
LPAADAGALL HFIEGNDRPG SNPRALALLL QQHQQQHQQQ PSSSGSGAAP DGNSPLEDGP  300
GQTSPRHPER TDSGSRGGIA RLVRAAEALG RAGGSSSRSA GAWADRDDAG QEPWEGAEPR  360
RRALLTAGSA TLAEEQPGRA AGRAGGALET GGDGLVAVRL AALEDAGLTL NLLPTGALVA  420
SGGPLGKQQL PLQLAPSGSG PNAPLLALLP ASVLLDLQDA RVAPGREQRA LEGLPGEAPG  480
QRPLLPPRTA SVTGGGREAA EGDQGSGEGF PDDSPPPPPL PPQQQQLGAA VQQLHGLLPP  540
RFATTGKPTS ASAGSLPPPS AAAAAAASLA VPPSAAQRSA SLPRASGQLG SQGAPLSAPG  600
GIGGGGGGAA GLPLSLLPAS ASDRSPTRWT KATSGPASAA SLPLGGSGVL LALPTPRSPH  660
LDGASAPGGS SAGGGGGGGP KRRRVSPDED DPDHVEDGGN ARGGRFGRGP GQGSGTPAAG  720
GKAPLMCHVD DCQVDLASLK EYHQRFRICD FHLKAEVVMR EGIPQRFCQQ CGRFHVLSEF  780
DGAKRSCRAR LMRHNARRRK RADAKEASVD YLLDEPRKLS RSTSGHTSSS APRAAAPQLP  840
LLQPLPPQQP PPPPLAPPNQ LFLQPLPDQP SSLYLPLQQM LFPPDAEGQP IVPGSGGGGG  900
SATGLPPPLQ PPLAAREAAA ATAGGGGSGG GVPSAPLLRL QQQLELQQDL LLRQRGRETQ  960
QQPQQRLERA PSQQQVPQQQ RPRLAAAAAP GGGELRAGDG VLEALLGLNH AGGGSAPPPA  1020
SERQAEAAAA AAVLSLRATV RHYGPTTAAA AASAAVANGG GSEAEPGSQR EQVPPNQPTH  1080
GSVSQAAPPE LSQLRTAGVQ LAAAAAATVT GKGAKGEGPL GPAATGEASP SRGPEAKPED  1140
AGHRAGAPQP GAMPGQRPAE DAPAPKLAEP SPAAGEAGAP GGASDGAGDG GEAGRAGAAA  1200
APGDGSPGVG GGAQQSRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-25718800284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1680684KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150FVP10.0A0A150FVP1_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.18e-21squamosa promoter binding protein-like 3