PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ41330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 102aa    MW: 11088.3 Da    PI: 6.7505
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ41330.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP78.41.1e-243594160
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS-- CS
         SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekr 60
                +Cq++gC adls +k+y+rr++vCe+h +a+vvl+sg+  rfC qCs fh+ls fD ++r
  KXZ41330.1 35 RCQADGCLADLSGLKRYFRRYHVCETHIRAQVVLISGRPVRFCDQCSTFHALSFFDGTRR 94
                6*******************************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-263094IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.02533102IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-223594IPR004333Transcription factor, SBP-box
PfamPF031101.5E-233694IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MSYQAEGSGG DGLDLAGGTA DGERVNQGAE VTANRCQADG CLADLSGLKR YFRRYHVCET  60
HIRAQVVLIS GRPVRFCDQC STFHALSFFD GTRRWEAGRG GE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-1436941169squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002952986.11e-31hypothetical protein VOLCADRAFT_93794
SwissprotA2YFT92e-17SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE82e-17SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A150FWC11e-68A0A150FWC1_GONPE; Uncharacterized protein
STRINGXP_002952986.14e-31(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.45e-18squamosa promoter binding protein-like 10