PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U039100.1.p
Common NameGLYMA_U039100, LOC100797650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 310aa    MW: 34425.2 Da    PI: 6.7765
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U039100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.6e-20147201256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq  +Lee F+++++++ ++++eLA+kl+L  rqV vWFqNrRa+ k
  Glyma.U039100.1.p 147 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTK 201
                        78889************************************************98 PP

2HD-ZIP_I/II1154.6e-37147235189
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                        +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+ +d+e Lk+++d+l+ en++L+ke +eL++
  Glyma.U039100.1.p 147 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTKLKQTVSDCELLKKCCDTLTVENKKLQKELQELKS 235
                        69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-18142204IPR009057Homeodomain-like
PROSITE profilePS5007117.491143203IPR001356Homeobox domain
SMARTSM003892.1E-15145207IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-17145204IPR009057Homeodomain-like
CDDcd000861.09E-14146204No hitNo description
PfamPF000462.7E-17147201IPR001356Homeobox domain
PROSITE patternPS000270178201IPR017970Homeobox, conserved site
PfamPF021835.3E-7203236IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-14203246IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSFHDTSNTG LGLGLGLGLV SFHDQSGNCM KSTNNDPMRE SHKIKKVENP SSKCNNTYPS  60
LTLGPPDDDD GDDDDEVNNN NQPSSKTESY EYFRPQVSSP SAVSSFSNSS SIKRERDQVL  120
GGEEFEVVVE KVPTRVVGDV DEDGNPRKKL RLTKEQAAVL EENFREHSTL NPKQKQELAM  180
KLNLRARQVE VWFQNRRART KLKQTVSDCE LLKKCCDTLT VENKKLQKEL QELKSMQATP  240
VPLYMQIPAA TLSICPSCER ICGGNENNGD NNNNGSSHTT TLLIGSKTHH HSFYKSNNYP  300
FPHSSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.385300.0meristem| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U039100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0994120.0BT099412.1 Soybean clone JCVI-FLGm-13F4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556960.10.0homeobox-leucine zipper protein HAT9
SwissprotA2XE766e-62HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL46e-62HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLI1J4030.0I1J403_SOYBN; Uncharacterized protein
STRINGGLYMA0041S00350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-48HD-ZIP family protein