PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U029500.1.p
Common NameGLYMA_U029500, LOC102668006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 147aa    MW: 17138.5 Da    PI: 10.8376
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U029500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.9e-1061105549
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                        ++ rr+q+NRe+ArrsR RKk  +e+L +    L  eN++++++l
  Glyma.U029500.1.p  61 RKLRRMQSNRESARRSRWRKKRHLENLMNQLNRLRMENQKYRNRL 105
                        6789*************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-857121IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9159105IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-961115No hitNo description
PfamPF001701.3E-761105IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-761112No hitNo description
CDDcd147024.78E-1262111No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MFFHEEAEAV QSSYFPVLET MFTPSEIEEL FSLVNEPASP GSGSGSGSQG SNRAVRSSHE  60
RKLRRMQSNR ESARRSRWRK KRHLENLMNQ LNRLRMENQK YRNRLFLTMH QNLLLSLENE  120
RLRSESMTLM ARLSDLYQIL GTMISQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U029500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150362e-94AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595997.11e-101bZIP transcription factor 2
RefseqXP_028199931.11e-101bZIP transcription factor 2-like
TrEMBLA0A445H3Z41e-100A0A445H3Z4_GLYSO; BZIP transcription factor 44
TrEMBLI1M8V41e-100I1M8V4_SOYBN; Uncharacterized protein
STRINGGLYMA14G10020.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59963052
Representative plantOGRP1173246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.12e-16basic leucine-zipper 5