PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U024400.1.p
Common NameGLYMA_U024400, LOC100810352
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 314aa    MW: 35918.6 Da    PI: 8.5848
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U024400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.41.8e-131051243
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                       +i n+s+r+    kR++ +lKK eELS LC++e++ i+++++
  Glyma.U024400.1.p 10 FIGNDSKRKNVCKKRKQSLLKKTEELSMLCGVEACAIVYGPN 51
                       7999************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.568151IPR002100Transcription factor, MADS-box
CDDcd002669.83E-24285No hitNo description
SuperFamilySSF554553.66E-19495IPR002100Transcription factor, MADS-box
PfamPF003192.0E-131052IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAPGKLKLTF IGNDSKRKNV CKKRKQSLLK KTEELSMLCG VEACAIVYGP NDPRPVIWPS  60
EFGVENVLRK FMSMPHWEQS KKMVNQESFI AQSIMKSKEK LQKIVKENKD IEMSLFMAHC  120
FKTGMFQPDI NMTTADMNVL ASIIEQNLKD IDKRMEMLKA NQVIPNQPDV ETSTLQPQIM  180
HTLTYQPPMQ TFAFQPQIQI PEFQTQIQTP EFPTQTYQSK MQTQTFQPQM QSPALFQPRM  240
QSLAFFQPQI MQTPSYQPQI MQTPSYQPHM QTPALEDMTL LNYGNGSGMQ MQQFNGNGYE  300
TTMLAFGGAN FPL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U024400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2357390.0AC235739.1 Glycine max strain Williams 82 clone GM_WBb0002K19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537339.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A0B2PWH70.0A0A0B2PWH7_GLYSO; Agamous-like MADS-box protein AGL80
STRINGGLYMA11G30482.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3681922
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.19e-38AGAMOUS-like 80