PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U021300.1.p
Common NameGLYMA_U021300, LOC778106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 311aa    MW: 34162 Da    PI: 7.7147
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U021300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.91.4e-403596263
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                       +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Glyma.U021300.1.p 35 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 96
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282388IPR003851Zinc finger, Dof-type
PfamPF027013.7E-343793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6463993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDPSSGQHQQ MSSQSLENML ACSKAHQERK PTPQPEQALK CPRCDSTNTK FCYYNNYSLS  60
QPRYFCKSCR RYWTKGGTLR NVPVGGGCRK NKRSSSSSST SKRVQDQAFT PNVNPLTGLP  120
SLMSYDSNDL TLALARLQKQ SCGQLGYDDH DLSMLGNHHT NTPCGDNILG MHHHSSSSST  180
NPGFLDALRS GFLGTQSNNN MHQNMYYGYG NGDMGEVDNG GGVGVSSSGE MMMMMMPYNN  240
DQEMSIASTQ AVTVTTMKQE ICNGREQKVL WGFPWQLNGD TNMGELDSGR ASNWNGINSS  300
WHGLLNSPLM *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286330.0meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U021300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572630.0DQ857263.1 Glycine max Dof13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538037.10.0dof zinc finger protein DOF2.1
TrEMBLA0A445I1Q60.0A0A445I1Q6_GLYSO; Dof zinc finger protein DOF2.1 isoform A
STRINGGLYMA11G15761.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.11e-43Dof family protein