PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U018600.1.p
Common NameGLYMA_U018600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 241aa    MW: 26568.6 Da    PI: 7.0564
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U018600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.9e-1076121550
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         +++r   NReA r++R++Kka ++ Lee+vk+L   N++L  +l+
  Glyma.U018600.1.p  76 SKQKRPSGNREAVRKYREKKKAHTAYLEEEVKKLHMVNQQLVRKLQ 121
                        57999999*********************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-872139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-1372140No hitNo description
PROSITE profilePS502178.81874140IPR004827Basic-leucine zipper domain
PfamPF077164.6E-1474129IPR004827Basic-leucine zipper domain
CDDcd146863.03E-1077131No hitNo description
SuperFamilySSF579594.13E-777121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MDDGNAELSD KLSDNNVLFL NPESCSSFQA SSSSRTCTHT HTCNPPGPDA AHTHTCYHTH  60
TQVFAPEDDG RKHSNSKQKR PSGNREAVRK YREKKKAHTA YLEEEVKKLH MVNQQLVRKL  120
QGQALLEAEL ARLRSILARL KGKIDSELGA WPFQKQYCNT SYIFKEGDAG LECQKNNLPC  180
FHPHVGSSSQ VNICACGKSM IPLDGNCQPE MVDCQVDANN MTSTEGQTVD NIMSSASQDG  240
*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U018600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0926540.0BT092654.1 Soybean clone JCVI-FLGm-11O24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237285.20.0basic leucin zipper protein
RefseqXP_025983390.10.0basic leucin zipper protein isoform X1
SwissprotQ8GTS29e-49BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A445I2330.0A0A445I233_GLYSO; Basic leucine zipper 23 isoform A
STRINGGLYMA11G16050.50.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51960.12e-25basic leucine zipper 24
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]