PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U015800.1.p
Common NameGLYMA_U015800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 225aa    MW: 24574.5 Da    PI: 9.7009
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U015800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1314.1e-4156133178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v g+eqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Glyma.U015800.1.p  56 RCQVEGCHVALLNAKDYHRRHKVCEMHSKAPKVVVLGMEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSSH 133
                        6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-3552118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.34254131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-3955136IPR004333Transcription factor, SBP-box
PfamPF031102.2E-3257130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
LGKRHYFEDT SGSGSVVGAA TFGGGLVYGD KRGKGYSSGG GAGVKAAGFA AATVPRCQVE  60
GCHVALLNAK DYHRRHKVCE MHSKAPKVVV LGMEQRFCQQ CSRFHVVSEF DDSKRSCRRR  120
LAGHNERRRK SSHDSVARNS SQAGGCALSL LSSRSDSWLS PSDLSTRCSA ALRELIAENR  180
AAIMARQFVS DRSHLHSHHH AVEDLKDIQP ESNYFPQQMY PQTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30571301184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.U015800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-69AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025983401.11e-166squamosa promoter-binding-like protein 7
SwissprotQ01JD13e-56SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT423e-56SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A445M0281e-130A0A445M028_GLYSO; Squamosa promoter-binding-like protein 7
TrEMBLK7K2H71e-130K7K2H7_SOYBN; Uncharacterized protein
STRINGGLYMA11G16556.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-37squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]