PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G200500.1.p
Common NameLOC100785293
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 400aa    MW: 44500.9 Da    PI: 6.6495
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G200500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.61.5e-125283851374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          l+++L++cA+ ++ g+++ a +l+++++ l a  +    + ++aa+f  AL++r+++       ++p+s++      e+   ++ ++e++
  Glyma.20G200500.1.p  28 LIHTLMTCADSLQRGHFSFAASLIQNMQGLlAHVNTnCGIGKVAACFIDALRRRISN-------KFPASSA-----YENDVLYHNYYEAC 105
                          689*************************996443332699****************9.......3444444.....344456788***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+lkf+h+taNqaIlea++g+++vH+iDf+++qGlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++++++l+e+g rLa++A++++v+f f
  Glyma.20G200500.1.p 106 PYLKFAHFTANQAILEAFNGHDCVHVIDFNLMQGLQWPALIQALALRPGGPPLLRLTGIGPPSAENRDNLREIGLRLAELARSVNVRFAF 195
                          ****************************************************************************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          + ++a rled+++++L+v+p+Ea+aVn+++qlhrl + + ++e+    vL  ++ l+Pk+v+vveqea+hn+e Flerf+eal+yys++f
  Glyma.20G200500.1.p 196 RGVAAWRLEDVKPWMLQVSPNEAVAVNSIMQLHRLTAVKSAVEE----VLGWIRILNPKIVTVVEQEANHNGEGFLERFTEALHYYSSVF 281
                          **9888*****************************965555555....****************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          dsl+a   + + +++ + +++l+rei+nvv+ceg +r erhe l+kWr+rl++aGF++++l+ +a+kqa++ll  ++ +g+ v+e++gsl
  Glyma.20G200500.1.p 282 DSLDAC--PVEPDKAALAEMYLQREICNVVCCEGPARLERHEPLAKWRDRLGKAGFRALHLGFNAYKQASMLLTLFSAEGFCVQENQGSL 369
                          ***998..5678888889999********************************************************************* PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgW++rpL+++SaW+
  Glyma.20G200500.1.p 370 TLGWHSRPLIAASAWQ 385
                          ***************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.632365IPR005202Transcription factor GRAS
PfamPF035145.1E-12328385IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MSLPSHYHLS SDLPDFATTV EEHSGIRLIH TLMTCADSLQ RGHFSFAASL IQNMQGLLAH  60
VNTNCGIGKV AACFIDALRR RISNKFPASS AYENDVLYHN YYEACPYLKF AHFTANQAIL  120
EAFNGHDCVH VIDFNLMQGL QWPALIQALA LRPGGPPLLR LTGIGPPSAE NRDNLREIGL  180
RLAELARSVN VRFAFRGVAA WRLEDVKPWM LQVSPNEAVA VNSIMQLHRL TAVKSAVEEV  240
LGWIRILNPK IVTVVEQEAN HNGEGFLERF TEALHYYSSV FDSLDACPVE PDKAALAEMY  300
LQREICNVVC CEGPARLERH EPLAKWRDRL GKAGFRALHL GFNAYKQASM LLTLFSAEGF  360
CVQENQGSLT LGWHSRPLIA ASAWQAAPLG DDETLRFEH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-486938542375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.420550.0root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556343.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W71e-142GAI1_VITVI; DELLA protein GAI1
TrEMBLI1NHZ80.0I1NHZ8_SOYBN; Uncharacterized protein
STRINGGLYMA20G34260.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-121GRAS family protein