PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G176800.1.p
Common NameGLYMA_20G176800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 466aa    MW: 53170.4 Da    PI: 6.6879
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G176800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.99.5e-94844631374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+ A+av+++++    + La l +++s +gd++qR++ayf+ +L+arl+   s  y+ l  ++t+    +ee+ +++ ++ vsP+
  Glyma.20G176800.1.p  84 LIHLLLSTATAVDDNNMDSSLENLADLYQTVSITGDSVQRVVAYFVDGLSARLLTRKSPFYDMLMEEPTT----EEEFLSFTDLYRVSPY 169
                          689****************************************************9*****999998887....5667777889****** PP

                 GRAS  91 lkfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelg 173
                          ++f+h+taNqaIlea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    + +el+et++rL +f + +g
  Glyma.20G176800.1.p 170 FQFAHFTANQAILEAFEKEeernnRALHVIDFDVSYGFQWPSLIQSLSEKAtsGNRISLRITGFGK----NLKELQETESRLVNFSKGFG 255
                          *****************9988877789**********************99755566*********....99****************97 PP

                 GRAS 174 .vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                           + fef+ l    l   ++ +Lr k++E++aVnlv  l +l     +  + ++++L +v sl+P +vvvveqe +++  sFl rf+++l+
  Glyma.20G176800.1.p 256 sLVFEFQGL----LRGSRVINLRKKKNETVAVNLVSYLNTLS----CFMK-ISDTLGFVHSLNPSIVVVVEQEGSRSPRSFLSRFTDSLH 336
                          689*****8....77778899***************999997....3333.578************************************ PP

                 GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkv...... 344
                          y++a+fdsl+  lp es er  +E++llg+ei++++ +  +      + e++e+W++r+e+ GF + ++s+k + qaklll++       
  Glyma.20G176800.1.p 337 YFAAMFDSLDDCLPLESAERLRIEKKLLGKEIKSMLNNDVDGgvDCPKYERMETWKARMENHGFVATKISSKSMIQAKLLLKMRthycpl 426
                          ************************************9986663356799********************************985222222 PP

                 GRAS 345 ..ksdg...yrveee.sgslv.lgWkdrpLvsvSaWr 374
                            +++g   +rv e+ +g ++ lgW++r L++vSaW+
  Glyma.20G176800.1.p 427 qfEEEGgggFRVSERdEGRAIsLGWQNRFLLTVSAWQ 463
                          1122223348887664555557**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.53958430IPR005202Transcription factor GRAS
PfamPF035143.3E-9184463IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MKDMEDSEED ELLNLSLSVA ADRERKKKGK TIREHNVSMS STTTTTRNSY ERKIFRLLQM  60
REQMLRQDHH RRKGVVEDGN GLPLIHLLLS TATAVDDNNM DSSLENLADL YQTVSITGDS  120
VQRVVAYFVD GLSARLLTRK SPFYDMLMEE PTTEEEFLSF TDLYRVSPYF QFAHFTANQA  180
ILEAFEKEEE RNNRALHVID FDVSYGFQWP SLIQSLSEKA TSGNRISLRI TGFGKNLKEL  240
QETESRLVNF SKGFGSLVFE FQGLLRGSRV INLRKKKNET VAVNLVSYLN TLSCFMKISD  300
TLGFVHSLNP SIVVVVEQEG SRSPRSFLSR FTDSLHYFAA MFDSLDDCLP LESAERLRIE  360
KKLLGKEIKS MLNNDVDGGV DCPKYERMET WKARMENHGF VATKISSKSM IQAKLLLKMR  420
THYCPLQFEE EGGGGFRVSE RDEGRAISLG WQNRFLLTVS AWQSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-41834633375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555429.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A0R0EMS00.0A0A0R0EMS0_SOYBN; Uncharacterized protein
STRINGGLYMA20G31680.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.15e-56GRAS family protein