PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G060400.1.p
Common NameGLYMA_20G060400, LOC100796748
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 410aa    MW: 44400.7 Da    PI: 4.5679
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G060400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.5e-06444539
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         +C+ +++++   +C+++  +lC +C  + H+       H++
  Glyma.20G060400.1.p  4 ICDFCGDQRSMVYCRSDAACLCLSCDRNVHSAnalskrHSR 44
                         7*****************************65677777765 PP

2zf-B_box21.16.5e-074688440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvv 40
                           C++++++++   C + +  lC++C   +H g       H+++
  Glyma.20G060400.1.p 46 LLCERCNSQPAFVRCVEEKISLCQNCDWLGH-GtstssstHKRQ 88
                         57*****************************.547778888765 PP

3CCT64.24e-22352395144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R +a++RYkeK+ktR F+Kk+rY+sRKa+A+ R RvKGrFvk+ 
  Glyma.20G060400.1.p 352 RSNAVMRYKEKKKTRMFDKKVRYASRKARADVRRRVKGRFVKAG 395
                          899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
CDDcd000211.08E-6447No hitNo description
SMARTSM003365.7E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7174390IPR000315B-box-type zinc finger
CDDcd000212.94E-44790No hitNo description
SMARTSM003361.64890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.279352394IPR010402CCT domain
PfamPF062033.3E-17352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGYICDFCGD QRSMVYCRSD AACLCLSCDR NVHSANALSK RHSRTLLCER CNSQPAFVRC  60
VEEKISLCQN CDWLGHGTST SSSTHKRQAI NCYSGCPSAA ELSSIWSFVL EIAAISESTC  120
EQELGLMSIN ENKCVGVPPE DQNVSGSDEV TDLPALNKSL VGASLMPESS SEPCILDQPA  180
GPTNECLPKL YCPATKCPAL SEDDNLYDDF NMDEVDLDLE NYEELFGMAL SHSEELFENG  240
GIDSLFGTKG MSAGDSNCQE AIAAEGSSVG QVNAMQPACS NAASADSILS TKTEPILCFT  300
GRQTQSNLSF SGVTGESSAG DYQDCGASSM LLMGEPPWFA PCPENSLQSA NRSNAVMRYK  360
EKKKTRMFDK KVRYASRKAR ADVRRRVKGR FVKAGDVYDY DPLSTTRSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.187350.0cotyledon| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.20G060400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0979890.0BT097989.1 Soybean clone JCVI-FLGm-22F8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605598.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_006605599.10.0zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE51e-155COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLK7N1D60.0K7N1D6_SOYBN; CONSTANS-like zinc finger protein
STRINGGLYMA20G07051.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-142CONSTANS-like 9