PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G035200.1.p
Common NameGLYMA_20G035200, LOC100807731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 483aa    MW: 52520.9 Da    PI: 6.9816
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G035200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.12e-38131191262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvP G+grrknk+ss
  Glyma.20G035200.1.p 131 PDKVLPCPRCNSMETKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPAGAGRRKNKNSS 191
                          78999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-30131188IPR003851Zinc finger, Dof-type
PfamPF027012.0E-31132189IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537135189IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137173IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MSEVKDPAIK LFGRTISLPH THINDSFSSA SASGPACAPS SSSSPREVTS SATQQQHEPE  60
EPSRKVLTSS QDDDDASHQT TEDLKSSTTS SGIFENPKTP SAETETSIPK SSTNGEKSEK  120
SASEEKTLKK PDKVLPCPRC NSMETKFCYY NNYNVNQPRH FCKNCQRYWT AGGTMRNVPA  180
GAGRRKNKNS SATVSHYRHI MFSEGLQGAT LNAPNGLHNA VMTFGPDSPL CDTMASMLNI  240
AERAQSCVPN GFHVTEPNSF VSYRKEEEEE DGTSGHSTGV NSVATTSTLS HSGSHESLDK  300
KVVEGFTPQF PYFPSAPWPY PIPPPTFFPQ GYPLSLYTTP AYWSYMPPSW NNNISAISPQ  360
SSVNNSVSNP TLGKHSRDGN IIASSNSQRE MHDMEHNSSE HNALIPKTLR IDDPREAAKS  420
SISMWSKLGI KNDDKASSGG LFKAFPSSKG NDINHQMVEA SSPVLQANPA ALSRSLTFRE  480
QT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.210120.0cotyledon| seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.20G035200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556733.10.0cyclic dof factor 1
RefseqXP_028220567.10.0cyclic dof factor 1-like
TrEMBLA0A0B2R5B80.0A0A0B2R5B8_GLYSO; Cyclic dof factor 2
TrEMBLK7N1760.0K7N176_SOYBN; Uncharacterized protein
STRINGGLYMA20G04600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-77cycling DOF factor 2