PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G006400.2.p
Common NameGLYMA_20G006400, LOC100812180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 983aa    MW: 108490 Da    PI: 7.5819
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G006400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-4093170178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Glyma.20G006400.2.p  93 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 170
                          6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3488155IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88991168IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3792172IPR004333Transcription factor, SBP-box
PfamPF031108.8E-3094167IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.31E-6729876IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.2E-4773875IPR020683Ankyrin repeat-containing domain
CDDcd002046.08E-5776875No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 983 aa     Download sequence    Send to blast
MDQVAPPPIL MHRKRDLSYA VVSPAPNPSW SWDWDSVRFA GKPPPPLSSP NDDVVFEESV  60
APPLQLNLGG RTNNSNSNKR VRSGSPGTSS YPMCQVDNCR EDLSKAKDYH RRHKVCEAHS  120
KASKALLANQ MQRFCQQCSR FHPLSEFDEG KRSCRRRLAG HNRRRRKTQP EDVTSATPAP  180
AAAANLEIFD LLTAIAGASQ DLATKLLDAG SGNVNGKKDQ VQLQTPSSYQ RHESHDQLNH  240
TPAAPLTMDL LAVLSTTLSG GSAPDASASP SQNHSCNSDG GSADQTRQQQ FFSVGGERSS  300
SSSRSPVEDS DCQEDVRVNL PLQLFSSSPE DDSLPKLASS RKYFSSDSSN PAEERSPSSS  360
PVVEMLFDLQ GGARGLKPES ISSGREVIAN KEASQSHSSN ISLDLFKGSN NRIQQPSSLQ  420
SVPFQAGYTS SGSDHSPPSL NSDAQDRTGR IMFKLFDKHP SHFPGTLRAQ IYNWLSNRPS  480
DMESYIRPGC VVLSIYASMS SADWEKLEEN FLQHVHSLIQ NSDSDFWRNG RFLVHSGSQF  540
VSHKDGKIRI CKPWRTWKSP ELISVSPLAI VSGHETSISL KGRNLSTPGT KIHCTGTGSY  600
ASAEVIGSAY SGVMYDKIKL SAFKVQDVSH GVLGRCFIEV ENGFKGNSFP VIIADETICK  660
ELRPLESEFD EEEKICDAIS EEHEHHFGRP RSREEALHFL NELGWLFQRE RFSYVHEVPY  720
YSLDRFKFVL TFAVERNCCM LVKTLLDVLV GKHLQGEWLS TGSVEMLNAI QLLNRAVKGK  780
YVGMVDLLIH YSIPSKNGTS RKYVFPPNLE GPGGITPLHL AAGTSGSESV VDSLTSDPQE  840
IGLKCWESLV DANGQTPHAY AMMRNNDSYN ALVAHKLADR RRGEISVTIE NAIEQQSLRV  900
ELKEKQSNLV KRGQSSCAKC ANAEFRFNRR VPGSHGLLHR PFIYSMLAVA AVCVCVCVFF  960
RGRPFVGSVA PFSWENLDYG TM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3384167184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.507500.0cotyledon| flower| hypocotyl| root| seed coat| somatic embryo| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.20G006400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353300.0AC235330.1 Glycine max strain Williams 82 clone GM_WBb0082G12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605456.10.0squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A0R0EEL00.0A0A0R0EEL0_SOYBN; Uncharacterized protein
STRINGGLYMA20G00900.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]