PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G006400.1.p
Common NameGLYMA_20G006400, LOC100812180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1010aa    MW: 111617 Da    PI: 7.7673
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G006400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-4093170178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Glyma.20G006400.1.p  93 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 170
                          6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-3488155IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88991168IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-3792172IPR004333Transcription factor, SBP-box
PfamPF031109.1E-3094167IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.47E-6756903IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.8E-4800902IPR020683Ankyrin repeat-containing domain
CDDcd002046.27E-5803902No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1010 aa     Download sequence    Send to blast
MDQVAPPPIL MHRKRDLSYA VVSPAPNPSW SWDWDSVRFA GKPPPPLSSP NDDVVFEESV  60
APPLQLNLGG RTNNSNSNKR VRSGSPGTSS YPMCQVDNCR EDLSKAKDYH RRHKVCEAHS  120
KASKALLANQ MQRFCQQCSR FHPLSEFDEG KRSCRRRLAG HNRRRRKTQP EDVTSATPAP  180
AAAANLEIFD LLTAIAGASQ GKFEEKRSQV PVREQLVQIL NRIPLPADLA TKLLDAGSGN  240
VNGKKDQVQL QTPSSYQRHE SHDQLNHTPA APLTMDLLAV LSTTLSGGSA PDASASPSQN  300
HSCNSDGGSA DQTRQQQFFS VGGERSSSSS RSPVEDSDCQ EDVRVNLPLQ LFSSSPEDDS  360
LPKLASSRKY FSSDSSNPAE ERSPSSSPVV EMLFDLQGGA RGLKPESISS GREVIANKEA  420
SQSHSSNISL DLFKGSNNRI QQPSSLQSVP FQAGYTSSGS DHSPPSLNSD AQDRTGRIMF  480
KLFDKHPSHF PGTLRAQIYN WLSNRPSDME SYIRPGCVVL SIYASMSSAD WEKLEENFLQ  540
HVHSLIQNSD SDFWRNGRFL VHSGSQFVSH KDGKIRICKP WRTWKSPELI SVSPLAIVSG  600
HETSISLKGR NLSTPGTKIH CTGTGSYASA EVIGSAYSGV MYDKIKLSAF KVQDVSHGVL  660
GRCFIEVENG FKGNSFPVII ADETICKELR PLESEFDEEE KICDAISEEH EHHFGRPRSR  720
EEALHFLNEL GWLFQRERFS YVHEVPYYSL DRFKFVLTFA VERNCCMLVK TLLDVLVGKH  780
LQGEWLSTGS VEMLNAIQLL NRAVKGKYVG MVDLLIHYSI PSKNGTSRKY VFPPNLEGPG  840
GITPLHLAAG TSGSESVVDS LTSDPQEIGL KCWESLVDAN GQTPHAYAMM RNNDSYNALV  900
AHKLADRRRG EISVTIENAI EQQSLRVELK EKQSNLVKRG QSSCAKCANA EFRFNRRVPG  960
SHGLLHRPFI YSMLAVAAVC VCVCVFFRGR PFVGSVAPFS WENLDYGTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3384167184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.507500.0cotyledon| flower| hypocotyl| root| seed coat| somatic embryo| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.20G006400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353300.0AC235330.1 Glycine max strain Williams 82 clone GM_WBb0082G12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555217.10.0squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLI1ND030.0I1ND03_SOYBN; Uncharacterized protein
STRINGGLYMA20G00900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Representative plantOGRP71381115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]