PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G260900.1.p
Common NameGLYMA_19G260900, LOC780540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 820aa    MW: 89791.1 Da    PI: 6.5779
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G260900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-1694138147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Glyma.19G260900.1.p  94 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 138
                          78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575128No hitNo description
SuperFamilySSF466898.97E-1788144IPR009057Homeodomain-like
PROSITE profilePS5129420.17389143IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-891141IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-1792141IPR006447Myb domain, plants
SMARTSM007171.1E-1293141IPR001005SANT/Myb domain
PfamPF002493.4E-1394137IPR001005SANT/Myb domain
CDDcd001671.63E-996139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MHDRTFNSLL LHHGFTSSSI TLSSASACFH HNGLTIWCVP CHKKRKEIFL LPTPRQGRSE  60
AALASSTRPL MDADSSGEEV LIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE  120
EHIGTKTAVQ IRSHAQKFFT KLEKEAFVKG VPIGQALDID IPPPRPKRKP NNPYPRKTNV  180
GGAPTLHSGA RHGKPLISIV SSLGKQALGL EKEPLPEKHD VDLRPSTVKE NKDQSCSKVF  240
TILQEAPCSS VSSANKNSTS ILVPLRNSCA LRKFIPSVKD VITQDETNDS FVTDDLENQK  300
LEIDDGKHTQ KSNGTCKVSK SENSGASELV QTEKTDGLNC ALTIEGVQGN QNYPRHVPVH  360
VVDGNLGTST QNPSPDMVFQ DSIFQPKGGV NGQPNLVTIS ATSNISESQN NTARSSIHQS  420
FPPCPTFTQD DYHSFLQVSS TFSSLIVSTL LQNPAAHAAA SFAATFWPYA NAETSADSPM  480
CTPDFPSRQI GSPPSVTAIA AATVAAATAW WAAHGLLPLC APLHTAFACP PASAIAVPLM  540
NIDESPQKTE QEEIKPQNSS LQDQILDPEH SEAQHSAPKS PAVFSSKSEE RGDANLNTSP  600
KATNHETNQV ISENPDSNKM KGRKPVDRSS CGSNTTSSSE ETELLLKDEK EKEEPKTPDA  660
NILDTELSNR RSRSINNLTD SWKEVSEEGR LAFQALFSRE VLPQSFSPTH DLINEDNQID  720
SIKDNDQNTD YKDEDLESKK CSSNCDGVQK NLLFVKDNNE EEGLLIIGLG PGKLKTRPTG  780
FKPYKRCSVE ANENRIGTAC NQGEEKGPKR IRLNGEAST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.301950.0flower| hypocotyl| leaf| meristem| pod| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G260900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764340.0EU076434.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 2 (LCL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604918.10.0protein LHY isoform X1
TrEMBLA0A0R0ETE00.0A0A0R0ETE0_SOYBN; Uncharacterized protein
STRINGGLYMA19G45030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Representative plantOGRP9903510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.17e-79circadian clock associated 1