PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G257500.1.p
Common NameGLYMA_19G257500, LOC778111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 253aa    MW: 27820 Da    PI: 8.7517
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G257500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.4e-382080262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprC stntkfCyynnysl+qPry Ck+CrryWt+GG+lrnvPvGgg+rknk+++
  Glyma.19G257500.1.p 20 PQEQLNCPRCSSTNTKFCYYNNYSLTQPRYICKTCRRYWTEGGSLRNVPVGGGSRKNKRVT 80
                         6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261578IPR003851Zinc finger, Dof-type
PfamPF027013.3E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4812478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEDIGPNSCT RQVAEKKARP QEQLNCPRCS STNTKFCYYN NYSLTQPRYI CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKRVT SSKVPPDLNP PSLSSVSAIS SQNPKMQGVH DLNLAFPTAM  120
DNYHGMSPYV EMPKLEIGGD HSTSHSHHHS PSAVELLRSG MASRGLNPYA PNSLMSTSDH  180
SLYTTGYPMQ EIKPNLSFSV DDGFGNRSYG VQENGGGRLL FPFGDIKHLS AGVEVEHIKE  240
RGNNSTGYWT GW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.226870.0hypocotyl| leaf| meristem| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G257500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966730.0BT096673.1 Soybean clone JCVI-FLGm-15N21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236737.20.0Dof18
RefseqNP_001338130.10.0Dof18
RefseqXP_006603759.10.0dof18 isoform X1
RefseqXP_006603760.10.0dof18 isoform X1
RefseqXP_006603761.10.0dof18 isoform X1
RefseqXP_028215981.10.0dof zinc finger protein DOF2.5-like
RefseqXP_028215982.10.0dof zinc finger protein DOF2.5-like
RefseqXP_028215983.10.0dof zinc finger protein DOF2.5-like
RefseqXP_028215984.10.0dof zinc finger protein DOF2.5-like
RefseqXP_028215985.10.0dof zinc finger protein DOF2.5-like
SwissprotQ433851e-57DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A0B2RSP10.0A0A0B2RSP1_GLYSO; Dof zinc finger protein DOF3.7
TrEMBLC6TGC30.0C6TGC3_SOYBN; Uncharacterized protein
STRINGGLYMA19G44670.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.46e-65Dof family protein