PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G208700.1.p
Common NameGLYMA_19G208700, LOC100806633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HB-other
Protein Properties Length: 1025aa    MW: 113955 Da    PI: 9.6016
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G208700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.96.1e-0769125157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +r+R  ++++ ++ ++++F  +  +s++e  e+++ lg+t +qV+ +F  +R + ++
  Glyma.19G208700.1.p  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKELHEISALLGVTVTQVRDFFNAQRSRVRR 125
                          799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.10666126IPR001356Homeobox domain
SMARTSM003891.7E-568130IPR001356Homeobox domain
SuperFamilySSF466898.13E-768132IPR009057Homeodomain-like
CDDcd000862.39E-569126No hitNo description
Gene3DG3DSA:1.10.10.601.0E-569130IPR009057Homeodomain-like
PfamPF000461.8E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.20.930.102.4E-5225309IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476762.22E-5231309IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MDAWNEDFSV LEIGSSAESF QKFLVSQKEL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKELHE ISALLGVTVT QVRDFFNAQR  120
SRVRRSVQLS RERVLSSNSC EEPHDDQINS DPMRPINPTP LNSAGQSNTE EASCSTQEVA  180
LPDLDDSDKQ FVDNIFSLIQ KEETFSGQEK LMEWILTIQN FSVLLWFLSR GGGMNLATWL  240
SKAAAEEQTS VLLLILKVLC HLPLHKAIPM HISAILQSVN KLRFYRTSDI SNRARVLLSK  300
WSKLFARNQV IKKPNGVKIS IDGHKEMMLS QSIGQFMGSE SWHSNIDVPE DILALSSECS  360
DNFRKMGSPQ GVKLLPPSLD DSNKKSSLGV SSSQSRERRK VQLVEQPGQK SVSRSSQVTR  420
AGPVSQGRPM SVDDIQKAKM RALFMQSKYG KSGSKESKET KIDSPNKQPQ TNPASIAACS  480
SKVPTPPKIE ENKKPLLLTS KTTNRLEASY SKPKMDVKEP LWEKCKRVQI PWRTPAEVEL  540
KDTWRVGGGE NSKEVEVQRN RNRRDKEIIY KTVQEMPPNP KEPWDLEMDY DDTLTLEIPI  600
EQLPDGDGAD IAISPNQVGT HTVQGVASTS STGVATAEPD LELLAVLLKN PELVFALTSG  660
QGGSIPNQET VKLLDMIKSG GVNLGLSENT NGSYGTSVKS PEKVEVSLPS PTPLSDPRTS  720
GWSSEASKNP FSRRSLAPDR ITQNHAAVAT TNLLSQIPIT GTTVRQQPTV VVPSSRHLTS  780
TSVSPYSLPH ATNVIPEKPS PLGQVQTSSD VGLTMKNLTT ANASSVNFPG THSTLALRGD  840
GTNYVKPVPN LSVQHEGLSN SFRQPFMPPS PTPSHSSLQQ QRHQHLTQEV HYTEPPYRNP  900
GRSYPPQIEK SDHGSDNMWR VRQDHVSSSY HSQRNHNNNY NTMVGGSRQS GFWDRNNHAR  960
GEFESWSPEN SPTRNPRYAP GRNYPESRMN HGRNPRPEWS RQRGSSGHWD PGRQGNRKWH  1020
DQRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.379400.0cotyledon| flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G208700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353490.0AC235349.1 Glycine max strain Williams 82 clone GM_WBb0092H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553647.10.0homeobox protein LUMINIDEPENDENS
RefseqXP_028217888.10.0homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A445FJL70.0A0A445FJL7_GLYSO; Homeobox protein LUMINIDEPENDENS
TrEMBLI1NB350.0I1NB35_SOYBN; Uncharacterized protein
STRINGGLYMA19G39620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-144HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]