PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G200300.1.p
Common NameGLYMA_19G200300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 173aa    MW: 19532.7 Da    PI: 7.9762
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G200300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.98e-371570661
               zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +cprC stntkfCyynnys +qPryfCk+CrryWtkGG+lrnvPvGgg+rk++++
  Glyma.19G200300.1.p 15 PNCPRCGSTNTKFCYYNNYSSTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRSA 70
                         58**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-24168IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1271569IPR003851Zinc finger, Dof-type
PfamPF027011.1E-311569IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101753IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MMEKWWKANN VEISPNCPRC GSTNTKFCYY NNYSSTQPRY FCKGCRRYWT KGGSLRNVPV  60
GGGCRKSRSA KYNKTFRQAN NSVGYSDDLM ASPNSVVSDA PSIDLAQVYA SFLNQKPDQA  120
VQTVRYPNEP DYYSCLLNTT DFGHSALSEE ELGLTDCLHF HEQSTESHFV AW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286340.0cotyledon
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G200300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572660.0DQ857266.1 Glycine max Dof16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554469.11e-125dof zinc finger protein DOF3.5
RefseqXP_028216334.11e-125dof zinc finger protein DOF3.5-like
SwissprotQ9SVC52e-46DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A0R0EQ321e-128A0A0R0EQ32_SOYBN; Uncharacterized protein
STRINGGLYMA19G38750.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-48Dof family protein