PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G146000.1.p
Common NameGLYMA_19G146000, LOC100807165
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 360aa    MW: 38546.7 Da    PI: 9.264
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G146000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.15.2e-4369145177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gl+qrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+ 
  Glyma.19G146000.1.p  69 RCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPSVIVAGLQQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPP 145
                          6**************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-3563131IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.39467144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-4168149IPR004333Transcription factor, SBP-box
PfamPF031105.4E-3370143IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MASDAKLSSS ESLNGLKFGQ KIYFEDVGLA TPATSLTSSS SSSSAATVTS SSSSRKGRGG  60
SVQPAQPPRC QVEGCKVDLS DAKAYYSRHK VCGMHSKSPS VIVAGLQQRF CQQCSRFHQL  120
PEFDQGKRSC RRRLAGHNER RRKPPTSSLL TSRYARLSSS AFDNSGRGSN FLMELTSYPK  180
LSLRNSLPTP RSSELAPGNQ TSTLSWNGNS ETSSDLFLQG SVGGTSFASP GHPPGESYIG  240
VTDTSCALSL LSNQTWGSRN TAPSLGLSNM INFNGTPLTQ LAASSHGASI HQLPNTSWFF  300
KGIDSGNCSP EVVPDLGLGQ ISQPLNSQLH GELDLSQQGR RHYMDLEQSR AYESAHWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32701431184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.209030.0flower| root| somatic embryo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G146000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553428.10.0squamosa promoter-binding-like protein 9
RefseqXP_028215958.10.0squamosa promoter-binding-like protein 9
TrEMBLA0A0B2QXU80.0A0A0B2QXU8_GLYSO; Squamosa promoter-binding-like protein 9
TrEMBLI1N9690.0I1N969_SOYBN; Uncharacterized protein
STRINGGLYMA19G32800.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-68squamosa promoter binding protein-like 9