PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G047500.1.p
Common NameGLYMA_19G047500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10734.5 Da    PI: 10.1176
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G047500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.92.7e-13950142
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         k i+ ++  ++t+  R++g++KK +E S++C++e+++i++ +
  Glyma.19G047500.1.p  9 KHISKERSHKTTLMLRKKGLIKKIFEFSTMCGVEACLIVYDN 50
                         67999999*******************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-7162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.442152IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-15181IPR002100Transcription factor, MADS-box
PfamPF003195.2E-121151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MGHARITLKH ISKERSHKTT LMLRKKGLIK KIFEFSTMCG VEACLIVYDN GNNGDVAPLT  60
CPRDPTVVHS ILQKYESKKN NEKSHKNFGI QDFF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G047500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001356230.11e-37agamous-like MADS-box protein
TrEMBLK7MWL14e-64K7MWL1_SOYBN; Uncharacterized protein
STRINGGLYMA19G06484.16e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-12M-type_MADS family protein