PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G023200.1.p
Common NameGLYMA_19G023200, Glyma19g02710.1, LOC778120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 386aa    MW: 41961.7 Da    PI: 4.6951
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G023200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-39121180261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG +rnvPvG+grrknk+ 
  Glyma.19G023200.1.p 121 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGVMRNVPVGAGRRKNKNF 180
                          7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30111178IPR003851Zinc finger, Dof-type
PfamPF027016.7E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLESKDSTMK LFGKTIPAPE ISAGAPALSS GDADAVGVVQ NHGSSSVNGD GEEHEIEQDI  60
MGEETTESEK EDEVTNLDTV SRPGEVSINP STKKEDLTLK TSKKTEQEQG ENSQDKTLRK  120
PDKILPCPRC NSMDTKFCYY NNYNVNQPRH FCKNCQRYWT AGGVMRNVPV GAGRRKNKNF  180
TSQYRQITVP EAALLSSQPD LPNGVSHPSL NCNATLLAFG SDTPLCESMT SVLNLAEKAV  240
NNSTTNGFNG SEELEIPFAY VAGEKVNDDS NKSSDMSTKP MEGETTNRSQ EQVIENCHPF  300
PPHAPYFPGA PWPFPWNPAL WNSPVPSPPA FFPQGFTMPL YPAAAYWGLT IPGAWSIPWL  360
AQPSLPNSTV SNSGPDPIAR TIAMS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.184860.0hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G023200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311470.0KT031147.1 Glycine max clone HN_CCL_144 C2C2-Zn Dof transcription factor (Glyma19g02710.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236866.20.0C2C2-Zn Dof transcription factor
RefseqXP_028216461.10.0cyclic dof factor 2-like
TrEMBLA0A445FBB20.0A0A445FBB2_GLYSO; Cyclic dof factor 2
TrEMBLI1N6540.0I1N654_SOYBN; C2C2-Zn Dof transcription factor
STRINGGLYMA19G02710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3665322
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-62cycling DOF factor 2
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]