PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G021100.1.p
Common NameGLYMA_19G021100, LOC100816097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 293aa    MW: 33500.3 Da    PI: 7.4278
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G021100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.12.9e-1889141456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Glyma.19G021100.1.p  89 KKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 141
                          556899**********************************************9 PP

2HD-ZIP_I/II128.72.3e-4187179193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n++L++++++L++e
  Glyma.19G021100.1.p  87 EKKKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDSLKSQNQKLHTE 176
                          69***************************************************************************************9 PP

          HD-ZIP_I/II  91 lke 93 
                          l++
  Glyma.19G021100.1.p 177 LQT 179
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.6E-1886147IPR001356Homeobox domain
PROSITE profilePS5007116.71487143IPR001356Homeobox domain
SuperFamilySSF466893.76E-1987145IPR009057Homeodomain-like
CDDcd000867.60E-1688144No hitNo description
PfamPF000461.8E-1589141IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-1990150IPR009057Homeodomain-like
PRINTSPR000311.0E-5114123IPR000047Helix-turn-helix motif
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5123139IPR000047Helix-turn-helix motif
PfamPF021832.7E-14143182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAFPPSHTFM FQTHEDHDPH QLHLRSTSTS LNAFPSFPPH HFQGAGGLMM KRSMSFSGID  60
NNNNNNKCDE SHGDDELSDE GSQLLGEKKK RLSLEQVKAL EKSFELGNKL EPERKMQLAK  120
ALGLQPRQIA IWFQNRRARW KTKQLEKEYE VLKKQFEAVK ADNDSLKSQN QKLHTELQTL  180
KRRDCNETGT VISLKKETDQ GSWSNGSNNS SEINLDLSRT PVMNTSPVSS QNGKSLLPTT  240
SSKPTSITQL LQCSSRPDLQ DESFCNMFHI IDEQQNFWPW PDHQQQQQHQ FH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.344570.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.19G021100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0956290.0BT095629.1 Soybean clone JCVI-FLGm-19L17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554392.10.0homeobox-leucine zipper protein HAT7
RefseqXP_028216947.10.0homeobox-leucine zipper protein HAT7-like
SwissprotQ004663e-81HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A445FB830.0A0A445FB83_GLYSO; Homeobox-leucine zipper protein HAT7
TrEMBLI1N6390.0I1N639_SOYBN; Uncharacterized protein
STRINGGLYMA19G02490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-73homeobox 3