PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G260500.1.p
Common NameGLYMA_18G260500, LOC100788247
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 502aa    MW: 54273 Da    PI: 6.7275
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G260500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.6e-40137197262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Glyma.18G260500.1.p 137 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSA 197
                          7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-31134194IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32139195IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947141195IPR003851Zinc finger, Dof-type
PROSITE patternPS013610143179IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MSEVKDPAIK LFGKTIPVPE IPRGSAGAPA SSSGDVVDDS VDASSTNSSR ESHTKRDALG  60
KDVDKDTLGE KPTDDKKEDG APTQSSEEVT NLDTASGSCE ESVALSTERE ATTLKTTKTE  120
EEQSETSNSQ DKNLKKPDKI LPCPRCNSMD TKFCYYNNYN VNQPRHFCKN CQRYWTAGGT  180
MRNVPVGAGR RKNKSSASHY RQITVSEAAL QNPRTDLPNG AYHPSLKCNG TVLTFGTDTP  240
LCESMASVLN LADKTMPNYT RNGFHKPEEL RIPVPHASGE KGDDQSNKSS VTSTTSVEGA  300
ITNGPKEQVV QNCQSFPPQV PYFPGTPWPI PWNPVQWSSP VPPPAFCPPG FTMPFYPATA  360
YWGCAVPGTW NIPWLVQPSS PNGATPNSGP NSPTLGKHSR EDSTFKSNES GGEDGHSKEN  420
NKEKSLWVPK TLRIDDSEAA KSSIWATLGI KNDKADSVPG GTLFKAFPSK HDDKNHSMQA  480
SPVLQANPAA LSRSLNFHET S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.288820.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G260500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551736.10.0cyclic dof factor 2
TrEMBLI1N4E50.0I1N4E5_SOYBN; Uncharacterized protein
STRINGGLYMA18G49520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-103cycling DOF factor 2