PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G258400.1.p
Common NameGLYMA_18G258400, LOC100783460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30541.4 Da    PI: 7.6486
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G258400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.71e-1880132456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          + +++ eq+++Le+ F + +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Glyma.18G258400.1.p  80 KKRLNLEQVKALEKSFDQGNKLEPERKVQLAKALGLQPRQVAIWFQNRRARWK 132
                          4568889*********************************************9 PP

2HD-ZIP_I/II1261.7e-4078170193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekk+rl+ eqvk+LE+sF++ +kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n+ L+  +++L++e
  Glyma.18G258400.1.p  78 EKKKRLNLEQVKALEKSFDQGNKLEPERKVQLAKALGLQPRQVAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDVLKVRNQKLQAE 167
                          69***************************************************************************************9 PP

          HD-ZIP_I/II  91 lke 93 
                          l++
  Glyma.18G258400.1.p 168 LQA 170
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1970136IPR009057Homeodomain-like
PROSITE profilePS5007117.0774134IPR001356Homeobox domain
SMARTSM003894.0E-1877138IPR001356Homeobox domain
CDDcd000862.27E-1679135No hitNo description
PfamPF000465.6E-1680132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.1E-1986133IPR009057Homeodomain-like
PRINTSPR000317.2E-6105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000317.2E-6114130IPR000047Helix-turn-helix motif
PfamPF021831.1E-11134173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAFLPSHGFT FNTTHEEDHC HFPPTSLDPF PSLPPQHFQG GAPFMLKRSM SLSGIENKCN  60
EVHGDDELSD DGVFQSGEKK KRLNLEQVKA LEKSFDQGNK LEPERKVQLA KALGLQPRQV  120
AIWFQNRRAR WKTKQLEKEY EVLKKQFEAV KADNDVLKVR NQKLQAELQA VKSRDCCEAG  180
IISLKKETEG SWSNGNDNNS DLNLDPSRAL GLNSPISSHN IKNLLPNSLK PNSITQLLQD  240
DGLCNMFHNI DAPQNFWPRP DQHHQRFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.229510.0cotyledon| root
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 day after germination (DAG) in first rosette leaf primordia around the veins in the apical part of the leaf and close to the midvein in the basal part of the leaf. At later stage, expressed in new forming veins, and veins and fascicular cambium of mature leaves. {ECO:0000269|PubMed:12644682}.
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G258400.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351191e-161AC235119.1 Glycine max strain Williams 82 clone GM_WBa0029B22, complete sequence.
GenBankAC2352401e-161AC235240.1 Glycine max strain Williams 82 clone GM_WBb0029M05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551729.10.0homeobox-leucine zipper protein ATHB-20
SwissprotQ8LAT05e-81ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLI1N4C20.0I1N4C2_SOYBN; Uncharacterized protein
STRINGGLYMA18G49290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.11e-75homeobox protein 20