PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G182500.1.p
Common NameGLYMA_18G182500, LOC100801824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 738aa    MW: 82875.6 Da    PI: 6.5251
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G182500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.45.3e-1103657351374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+av+++d + a++lL++++++++p gd +qRla+ f+ +L+arl++++s++yk l +++ts    ++ l+a++l+  ++P+
  Glyma.18G182500.1.p 365 LRTLLVLCAQAVAADDYKGANELLKQIRQHSNPFGDGNQRLAHIFADGLEARLSGTGSQIYKGLVSKRTS---AADFLKAYHLYLAACPF 451
                          5789************************************************************999999...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k++ ++ N +I ++ +++ r+HiiDf+i +G+QWp+L+q L+  ++g+p+lRiTg++sp++g   +e++ etg+rLa +Ae+++v+fe+
  Glyma.18G182500.1.p 452 RKMTAFISNVTIRKSSANSPRLHIIDFGILYGFQWPTLIQRLSL-AGGAPKLRITGIDSPQPGfrPAERIVETGRRLAAYAESFKVEFEY 540
                          ******************************************99.79******************************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ +ak++e+++leeL+++++E l+V + ++ +++ldesv ++s+r+++L+l+++++P+++++   +   n++ F++rf eal +ys+lf
  Glyma.18G182500.1.p 541 NA-IAKKWETIQLEELKIDRDEYLVVTCFYRGKNVLDESVVVDSPRNKFLSLIRKINPNIFIHGITNGAFNAPFFVTRFREALFHYSSLF 629
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d+lea ++re+ er+ +E+e++gre+ nv+aceg er+er et+++W++r+ +aGF + p++ +++k a   + + + + + ++e+s++l
  Glyma.18G182500.1.p 630 DMLEAIVSREEWERMLIEKEIFGREALNVIACEGCERVERPETYRQWQARILRAGFLQQPFEREIVKRAIEKVTTSYHKDFVIDEDSQWL 719
                          *********************************************************************99999999888********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk+r ++++S+W+
  Glyma.18G182500.1.p 720 LQGWKGRIIYALSCWK 735
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.943339715IPR005202Transcription factor GRAS
PfamPF035141.8E-107365735IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MQRLMIMDPR LLGFSGSPNE IQLGNQRFEN GFFDQSREFG YLQSNLLPID TPSSSSVWTH  60
EEPSPEDCEF SDGILSYISQ ILMEEDMEDK TCMLQDSLDL QIAERSFYEV IGEKYPSSPL  120
GHPSSVDPDD GGGVDNFSEN YGTCSYNDGD LSSIFTNNSL RRNLGELPNQ NFRGNSISRS  180
SYSSPNSVIS SVEGPVDSPS SILQVPDLNS ETQSILQFQK GVEEASKFLP SGNGLFANLG  240
VANFSKLEPR VGSDELPVKV EKDEGESFPA GSKIRKHHHR EEGGVEENRS SKQAAIFSEP  300
TLRSSMIDII LLHSLGDGKK HFMARREALQ TKNEKIVVSN GKSKASNGGK GRSKKQNGKK  360
EVVDLRTLLV LCAQAVAADD YKGANELLKQ IRQHSNPFGD GNQRLAHIFA DGLEARLSGT  420
GSQIYKGLVS KRTSAADFLK AYHLYLAACP FRKMTAFISN VTIRKSSANS PRLHIIDFGI  480
LYGFQWPTLI QRLSLAGGAP KLRITGIDSP QPGFRPAERI VETGRRLAAY AESFKVEFEY  540
NAIAKKWETI QLEELKIDRD EYLVVTCFYR GKNVLDESVV VDSPRNKFLS LIRKINPNIF  600
IHGITNGAFN APFFVTRFRE ALFHYSSLFD MLEAIVSREE WERMLIEKEI FGREALNVIA  660
CEGCERVERP ETYRQWQARI LRAGFLQQPF EREIVKRAIE KVTTSYHKDF VIDEDSQWLL  720
QGWKGRIIYA LSCWKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-393697358375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014626525.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014626524.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_006602599.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014626523.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_006602598.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014626522.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_006602595.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014626521.10.0PREDICTED: scarecrow-like protein 9 isoform X1
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0R0F2370.0A0A0R0F237_SOYBN; Uncharacterized protein
STRINGGLYMA18G39920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein