PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G176300.1.p
Common NameGLYMA_18G176300, LOC100816936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 364aa    MW: 38158 Da    PI: 9.1908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G176300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.3e-3879137361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e+ +kcprC+stntkfCy+nnyslsqPr+fCkaCrryWt+GG+lrnvPvGgg+r+nk+s
  Glyma.18G176300.1.p  79 EAPQKCPRCESTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGTLRNVPVGGGCRRNKRS 137
                          56789***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2564127IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3281136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24582136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVYTSIPSYI DPANWQQQQP NHQQQGNNTA ASSHLILPPP IQPPPPPPSQ PHGLSGSTTA  60
GSIRPGSMAD RARMANIQEA PQKCPRCEST NTKFCYFNNY SLSQPRHFCK ACRRYWTRGG  120
TLRNVPVGGG CRRNKRSRGS SSSNTRSPAN SDRQTASAGS ASTTSGSSSA DLVASLGGGT  180
GVPPSLRFMA PLHQLGDHHH LGGGGGEIGL SYGLNYGAIS GPMGGIGDLN FHIGGTLSGG  240
GSMLSGLDQW RVPQTHQFPF LSGLEATSSH GLYPFEGASG SDGYGGTPIK VSTSGIISQL  300
ASVKMEDNRH HHHQELGLPR QFLGVNNNPN TNEQYWSGGG GATSTWTDLS AFSSSSTTSN  360
NAL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G176300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551443.10.0dof zinc finger protein DOF2.4
TrEMBLI1N2E00.0I1N2E0_SOYBN; Uncharacterized protein
STRINGGLYMA18G38560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-33DNA binding with one finger 2.4