PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G150800.1.p
Common NameGLYMA_18G150800, LOC102663483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 370aa    MW: 39887.4 Da    PI: 9.0702
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G150800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.7e-383190261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +e+ +kcprCds+ntkfCyynnysl+qPr+fCk+CrryWt+GGalr vP+Ggg+rknk++
  Glyma.18G150800.1.p 31 PEQGVKCPRCDSSNTKFCYYNNYSLTQPRHFCKTCRRYWTNGGALRSVPIGGGCRKNKRA 90
                         67899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-272989IPR003851Zinc finger, Dof-type
PfamPF027012.0E-323389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.053589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MVPPPENMAA PKDQDATQGR KITTTTTRPA PEQGVKCPRC DSSNTKFCYY NNYSLTQPRH  60
FCKTCRRYWT NGGALRSVPI GGGCRKNKRA VVKPSSSSSS SSPRLSTTEF SLRGLNVPPS  120
VEFNLGALPF PSRLNTNHHI PTIINTGLFN NNQLSPFLDV KSALFQLDAP PAALSNSLMG  180
IAPPSAQNNN FWALGRSQSS TLSDPLNSTM QSMQQSLNVH SSLASSIESL SCVNRDLHLK  240
MQQQRYATMM SGGDTHHKGD ENSGVSFPQT VNGFENQKLV MNPVMFQKPV ESLPAGSAVT  300
EGPSGASVTT VAPPTEWFFG NSSFPSTGNG GGNGNNNINI NINDANNNWS DALAWGNFQQ  360
QQQQYSALP*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO229273034e-64
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G150800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150342e-56AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603380.10.0dof zinc finger protein DOF5.7
TrEMBLK7MSC70.0K7MSC7_SOYBN; Uncharacterized protein
STRINGGLYMA18G26870.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-35Dof family protein