PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G053300.1.p
Common NameGLYMA_18G053300, LOC100794935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 258aa    MW: 29214.7 Da    PI: 8.6339
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G053300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.92.6e-181051243
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         +i n+s+r++t+ kR++ +lKK eELS+LC++e++ i+++++
  Glyma.18G053300.1.p 10 FIANNSKRKTTYNKRKQSLLKKTEELSTLCGIEACAIVYGPN 51
                         899*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.357151IPR002100Transcription factor, MADS-box
CDDcd002661.84E-26285No hitNo description
SuperFamilySSF554552.49E-22394IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-8323IPR002100Transcription factor, MADS-box
PfamPF003195.9E-161052IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MARKKVKLAF IANNSKRKTT YNKRKQSLLK KTEELSTLCG IEACAIVYGP NDPRPEIWPS  60
ESGVINVLGK FKSMPQWEQT KKMANQERFI AESIVKGKEK LKKLADENKE KEMSLFMVQW  120
LKTGKVQPEH NMTMADFNVL SSMIDQNLKD IAKKMEMLNV NEVIPNQPQM QTPAFQPDIP  180
TSSFEPQMQN PSYQPQMQTP AFQTLMQAPA LVAYQPQMPT LTPEEMTLLN NGYGSDMNAN  240
PMQSQGFMDW LNGNGDD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G053300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552916.10.0agamous-like MADS-box protein AGL80
TrEMBLK7MQ380.0K7MQ38_SOYBN; Uncharacterized protein
STRINGGLYMA18G05976.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3654522
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-43AGAMOUS-like 80