PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G053200.1.p
Common NameGLYMA_18G053200, LOC100794409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 329aa    MW: 37387.8 Da    PI: 7.5388
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G053200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.45e-151153345
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                         + n+s+r++   kR++ +lKK eELS+LC++e++ i+++++++
  Glyma.18G053200.1.p 11 VANDSQRKTVCKKRKQSLLKKTEELSTLCGIEACAIVYGPNDH 53
                         689************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.512151IPR002100Transcription factor, MADS-box
SMARTSM004328.7E-16160IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-5323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-20495IPR002100Transcription factor, MADS-box
CDDcd002669.91E-24585No hitNo description
PfamPF003199.7E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MATGKLKLTF VANDSQRKTV CKKRKQSLLK KTEELSTLCG IEACAIVYGP NDHRPEIWPS  60
ESGVKNVLGK FMNKPQWEQS KKMMNQESFI AQSIMKSKDK LQKVVKENKE IEMSLFMAQC  120
FQTGMFQPDI NMTAADMNVL SSEIEQNLKD IDKRMEMLKA NQVTPNQPDI ESLTFQPQIM  180
QTSAFQPQIQ IPAFETQIQT QTYQSQMETP TFQPQMQSPA LFQPQIQTAS YQPHMQTQSY  240
HPHMQATSFP TQMQAPSYQP QMQTPAYQPD IQTLAFEPQM QTPAPEEMTL MNYGYGSGMN  300
ANHMHRQKFN GNGYETIMPA FGGAKLPL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11524QRKTVCKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G053200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2357390.0AC235739.1 Glycine max strain Williams 82 clone GM_WBb0002K19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552915.10.0MADS-box transcription factor PHERES 1
TrEMBLK7MQ370.0K7MQ37_SOYBN; Uncharacterized protein
STRINGGLYMA18G05963.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3654422
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-40AGAMOUS-like 80