PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G052900.1.p
Common NameGLYMA_18G052900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 212aa    MW: 24265.2 Da    PI: 10.0867
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G052900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.32.6e-101048240
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                         +i+ +s r+ t+ k ++g+lKK  E S+LC++e++ i+ 
  Glyma.18G052900.1.p 10 FISFDSARKLTYKKMKKGMLKKIDEPSTLCGIEACAIVW 48
                         6888999****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.446150IPR002100Transcription factor, MADS-box
SMARTSM004324.9E-6160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.76E-15285IPR002100Transcription factor, MADS-box
PfamPF003191.1E-81148IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTRKKVQPAF ISFDSARKLT YKKMKKGMLK KIDEPSTLCG IEACAIVWPS HWGVQRVLEK  60
FMSMPELEQS KKMVNQESFT AQSIMKGNKQ MMKLMKDNRR RSRARPDNNM TIANLNFLSR  120
MVDQNLKDID KRMETLKVNE MTQNIQPQMQ TPALNYALGS DMNTAEPMQN LWFMDFLNNG  180
DGDERLIMPA FGDANNSTPN WLLSFGGSCF S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVQPAFISFDSARKLTYKKMK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G052900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028186499.12e-80agamous-like MADS-box protein AGL80
SwissprotQ9FJK36e-29AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A0R0EWH81e-155A0A0R0EWH8_SOYBN; Uncharacterized protein
STRINGGLYMA18G05916.17e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3654222
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.16e-29AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]