PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G040000.1.p
Common NameGAI, GLYMA_18G040000, LOC100799695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 585aa    MW: 63889 Da    PI: 5.0027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G040000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS461.45.3e-1412095731374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lv++Ll+cAeav++++l+la+al++++  la++++ +m+++a+yf++ALa+r+++        + p+et +++ s++l++   f+e +P+
  Glyma.18G040000.1.p 209 LVHTLLACAEAVQQENLKLADALVKHVGILAASQAGAMRKVASYFAQALARRIYG--------IFPEETLDSSFSDVLHM--HFYESCPY 288
                          689****************************************************........44455544566677666..5******* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lkf+h+taNqaIlea++++ rvH+iDf++ qG+QWpaL+qaLa Rp+gpp++R+Tg+g+p+++++++l+++g++La++A+++gv+fef+ 
  Glyma.18G040000.1.p 289 LKFAHFTANQAILEAFATAGRVHVIDFGLRQGMQWPALMQALALRPGGPPTFRLTGIGPPQPDNTDALQQVGWKLAQLAQNIGVQFEFRG 378
                          ****************************************************************************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                          +v+++l+dl++++L+++pgEa+aVn+v++lhr+l++++s+++    vL++vk+++Pk+v++veqea+hn++ Fl+rf+eal+yys+lfds
  Glyma.18G040000.1.p 379 FVCNSLADLDPKMLEIRPGEAVAVNSVFELHRMLARPGSVDK----VLDTVKKIKPKIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDS 464
                          **********************************99999999....******************************************** PP

                 GRAS 271 leaklpres....eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveees 355
                          le + +++     +++  +++ +lgr+i+nvva+ega+r+erhetl++Wr rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++
  Glyma.18G040000.1.p 465 LEGSSSSTGlgspNQDLLMSELYLGRQICNVVANEGADRVERHETLSQWRGRLDSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENN 554
                          *99876665777999*************************************************************************** PP

                 GRAS 356 gslvlgWkdrpLvsvSaWr 374
                          g+l+lgW++rpL+++SaW+
  Glyma.18G040000.1.p 555 GCLMLGWHTRPLIATSAWK 573
                          ******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120414.4E-3744111IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.8E-3544117No hitNo description
PROSITE profilePS5098569.182183552IPR005202Transcription factor GRAS
PfamPF035141.8E-138209573IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MKRDHRDSCG GGGGGSVKGE CSSMPSNGKA NMWEEQQQQQ QGMDELLAAL GYKVRASDMA  60
DVAQKLEQLE MVMGCAQEEG ISHLASDTVH YDPTDLYSWV QTMLTELNPE PNNNNNSLLG  120
PSSLLIDNNT APVFNDDSEY DLRAIPGIAA YPPPPPQDNN NNNNNLDEIE TANNINKRLK  180
PSPVESADSA SEPTRTVLLV DHQEAGVRLV HTLLACAEAV QQENLKLADA LVKHVGILAA  240
SQAGAMRKVA SYFAQALARR IYGIFPEETL DSSFSDVLHM HFYESCPYLK FAHFTANQAI  300
LEAFATAGRV HVIDFGLRQG MQWPALMQAL ALRPGGPPTF RLTGIGPPQP DNTDALQQVG  360
WKLAQLAQNI GVQFEFRGFV CNSLADLDPK MLEIRPGEAV AVNSVFELHR MLARPGSVDK  420
VLDTVKKIKP KIVTIVEQEA NHNGPGFLDR FTEALHYYSS LFDSLEGSSS STGLGSPNQD  480
LLMSELYLGR QICNVVANEG ADRVERHETL SQWRGRLDSA GFDPVHLGSN AFKQASMLLA  540
LFAGGDGYRV EENNGCLMLG WHTRPLIATS AWKLPSPNDL HCKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-632095734375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.312270.0flower| hypocotyl| leaf| root| seed coat| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8574080.0EU857408.1 Glycine max gibberellic acid-insensitive mutant protein (GAI) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552980.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLI1MZE20.0I1MZE2_SOYBN; Gibberellic acid-insensitive mutant protein
STRINGGLYMA18G04500.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2