PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.18G005600.5.p
Common NameGLYMA_18G005600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 304aa    MW: 33255.2 Da    PI: 8.0669
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.18G005600.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.34e-42171247278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          CqvegC  dls+ak+yhr+h+vCe+hsk+p+v+++gle+rfCqqCsrfh+lsefD++krsCr+rL++hn+rrrk+q+
  Glyma.18G005600.5.p 171 CQVEGCGLDLSSAKDYHRKHRVCEAHSKSPKVVIAGLERRFCQQCSRFHALSEFDDKKRSCRQRLSDHNARRRKTQP 247
                          **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-35163232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.248168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-39169250IPR004333Transcription factor, SBP-box
PfamPF031102.1E-32171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEWNAKSLGQ WDWEHLFFNT KAAENPRLQP TDCSSEADPE INVGLLYPSG GSACSGSELI  60
HASSSRSSKS ASNNSSSNGD SRESILTLEG SQDDSTGKKE LCNGEPVETS PAAVPSPVSG  120
EPLLTLKLGK RLYFEDVCTG SDSKKPSSFE VPILSGKKYK TSSQTVQHPS CQVEGCGLDL  180
SSAKDYHRKH RVCEAHSKSP KVVIAGLERR FCQQCSRFHA LSEFDDKKRS CRQRLSDHNA  240
RRRKTQPDSI QLNPSALSSS PYGITGSFPS LGKSIACLAH WFSFAVYYFG MHIIHIIIFP  300
SQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271712441184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1226243KKRSCRQRLSDHNARRRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.18G005600.5.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939850.0BT093985.1 Soybean clone JCVI-FLGm-24F23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601888.10.0squamosa promoter-binding-like protein 12
RefseqXP_006601889.10.0squamosa promoter-binding-like protein 12
RefseqXP_006601890.10.0squamosa promoter-binding-like protein 12
RefseqXP_006601892.10.0squamosa promoter-binding-like protein 12
RefseqXP_006601893.10.0squamosa promoter-binding-like protein 12
RefseqXP_014626498.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214556.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214557.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214558.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214559.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214560.10.0squamosa promoter-binding-like protein 12
RefseqXP_028214561.10.0squamosa promoter-binding-like protein 12
SwissprotA2X0Q61e-59SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-59SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A0R0ETX40.0A0A0R0ETX4_SOYBN; Uncharacterized protein
STRINGGLYMA18G00903.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.39e-56squamosa promoter binding protein-like 2