PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G192800.1.p
Common NameGLYMA_17G192800, LOC100784144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 367aa    MW: 40852.9 Da    PI: 6.6131
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G192800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17244278135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Glyma.17G192800.1.p 244 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 278
                          99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.1E-829334IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.149238274IPR000679Zinc finger, GATA-type
SMARTSM004011.9E-17238288IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-16239302No hitNo description
Gene3DG3DSA:3.30.50.102.0E-14240275IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.14E-14243290No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15244278IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MESPSSSPIF PQFTFDNNNS DHFIVEDLLD FSNDDVVITD ATFDSITTDS STVTTTVHSC  60
NSSSFSGSDP NTVPDIGSRN LSDGHFSDDL CVPYDDIAEL EWLSNFVEES FSSEDLHKMQ  120
LISGMNAQNN DVSEAREFHY EPTTTRSGSH TPEPTRNSPI FNSEVSVPAK ARSKRSRGPP  180
CNWASRLLVL SPTSSSSDNE VVVPSPATAE PCPTPAKKMA KVGPRKKDSS SSDGNGSGGD  240
GRRCLHCATD KTPQWRTGPM GPKTLCNACG VRYKSGRLVP EYRPAASPTF VLTKHSNSHR  300
KVLELRRQKE MVRSQQHHHQ HQQQFLQHHH HNHHHYQHHQ NMMFDVSNGD DYLIHQYVGP  360
DFRQLI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.393700.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vascular cylinder of roots. Expressed in the differentiation zone of the root stele. {ECO:0000269|PubMed:25265867}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550120.10.0GATA transcription factor 12
RefseqXP_028210189.10.0GATA transcription factor 12-like
SwissprotP697812e-97GAT12_ARATH; GATA transcription factor 12
TrEMBLI1MWA90.0I1MWA9_SOYBN; Uncharacterized protein
STRINGGLYMA17G27110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-92GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]