PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G180600.1.p
Common NameGLYMA_17G180600, LOC778108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 353aa    MW: 37213.3 Da    PI: 8.4609
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G180600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3973129460
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+
  Glyma.17G180600.1.p  73 ENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKS 129
                          6789***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.1E-3374129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51675129IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2575126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MIQELLGGAL IAGERKPSSI NGGGGGGGVL LPITTPSPSS FPSSTTSDVT LTSTTTTAAT  60
TAATAATTTT AVENLRCPRC DSSNTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI  120
GGGCRKNKSI GVASSVAGKT ASTKMKTIAS EFGKSPGFGG GFEVEHELPP PPGQILWGSP  180
QNTHLLALLR ATQTQNPNPN PSPMSLKEEG TLLGHMVSTD QPLVSNTLLS YRTLGYDAVA  240
QVPSSLGLFG RNNQDQQQQN GGFLVGEHHN NSGIQELYQK LRSSSTVNNN YCSDNNSSQM  300
FMGNMASNYS SSVSNNILET TSVAGGEFGY WNGPTFSNWS DLPTTNGAGA YP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.278950.0hypocotyl| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G180600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572650.0DQ857265.1 Glycine max Dof15 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550086.10.0dof zinc finger protein DOF5.7
RefseqXP_028208836.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A445G8B40.0A0A445G8B4_GLYSO; Dof zinc finger protein DOF5.3
TrEMBLI1MW200.0I1MW20_SOYBN; Uncharacterized protein
STRINGGLYMA17G21540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-33TARGET OF MONOPTEROS 6