PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G162800.1.p
Common NameGLYMA_17G162800, LOC100808898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 483aa    MW: 53800.2 Da    PI: 6.0973
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G162800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS282.89.9e-87584792373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsP 89 
                          ++lL++cA+a++++d +laq++L+ l+++a  dgd++qRla+ f++AL ar a+  ++++k l +  t+ +  ++++++ +l  f++++P
  Glyma.17G162800.1.p  58 EQLLVHCANAIETNDVTLAQQILWVLNNIAPHDGDSNQRLASGFLRALTARAAK--TGTCKMLVSAGTNLSIDTHRFNIIELanFVDLTP 145
                          79****************************************************..8999999888887666666666666677****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg.....skeeleetgerLakfAee 171
                          +++f++ +aN a+lea+eg + vHi+D+++++++Q p+L +a+asR+   ++pp +++T+ ++   +        ++ee+g +L +fA++
  Glyma.17G162800.1.p 146 WHRFGFTAANAAVLEATEGFSVVHIVDLSLTHCMQIPTLVDAIASRQhhdAPPPIIKLTVADACCRDhippmLDLSYEELGAKLVSFARS 235
                          ***********************************************9888899******99977778888888899************* PP

                 GRAS 172 lgvpfefnvl...vakrledleleeLrvkp....................gEalaVnlvlqlhrll......................de 216
                           +v +ef+v+   + + +++l +e+Lrv++                     Eal++n++++lh+++                       +
  Glyma.17G162800.1.p 236 RNVIMEFRVVsssYQDGFASL-IEHLRVQQeqqqqqqqqhfvyaaepstpSEALVINCHMMLHYIPdetlsdttdltsyvydssssaaVS 324
                          *********866633333333.5666555555556667777788888999*********************************9999534 PP

                 GRAS 217 svsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerr 306
                           ++++s r+ +Lk +++l P+vv++v+++ad++s++++ r+ +a+++ +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+
  Glyma.17G162800.1.p 325 VTPTSSLRSLFLKSLRGLDPTVVILVDEDADLTSNNLVCRLRSAFNFLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGLQRV 413
                          444555899***************************************************************.***************** PP

                 GRAS 307 erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          er e ++kW+er+++a F+ v +se+ ++++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  Glyma.17G162800.1.p 414 ERVEPKNKWEERMKNASFQGVGFSEDSVAEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFASAW 479
                          ***************************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.65531461IPR005202Transcription factor GRAS
PfamPF035143.4E-8458479IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MTQFTPPLPP LHHQITSLLP NPNMMNKNQI PRPRPWPASG FPTTSKALSN LGNANCMEQL  60
LVHCANAIET NDVTLAQQIL WVLNNIAPHD GDSNQRLASG FLRALTARAA KTGTCKMLVS  120
AGTNLSIDTH RFNIIELANF VDLTPWHRFG FTAANAAVLE ATEGFSVVHI VDLSLTHCMQ  180
IPTLVDAIAS RQHHDAPPPI IKLTVADACC RDHIPPMLDL SYEELGAKLV SFARSRNVIM  240
EFRVVSSSYQ DGFASLIEHL RVQQEQQQQQ QQQHFVYAAE PSTPSEALVI NCHMMLHYIP  300
DETLSDTTDL TSYVYDSSSS AAVSVTPTSS LRSLFLKSLR GLDPTVVILV DEDADLTSNN  360
LVCRLRSAFN FLWIPYDTVD TFLPRGSKQR QWYEADICWK IENVIAHEGL QRVERVEPKN  420
KWEERMKNAS FQGVGFSEDS VAEVKAMLDE HAAGWGLKKE DEHIVLTWKG HNVVFASAWL  480
PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-14594796374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358870.0AC235887.2 Glycine max clone GM_WBc0029N01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550980.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-176SCL32_ARATH; Scarecrow-like protein 32
TrEMBLK7MLZ60.0K7MLZ6_SOYBN; Uncharacterized protein
STRINGGLYMA17G17710.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-168GRAS family protein