PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G157600.1.p
Common NameGLYMA_17G157600, Glyma17g16930.1, LOC100807123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 313aa    MW: 34422.9 Da    PI: 7.9901
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G157600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.9e-19164218256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Glyma.17G157600.1.p 164 RKKLRLSKEQSALLEESFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 218
                          788899***********************************************98 PP

2HD-ZIP_I/II124.74.4e-40164253191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq++lLEesF+++++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +
  Glyma.17G157600.1.p 164 RKKLRLSKEQSALLEESFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-A 252
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Glyma.17G157600.1.p 253 L 253
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.88E-18158221IPR009057Homeodomain-like
PROSITE profilePS5007117.443160220IPR001356Homeobox domain
SMARTSM003898.1E-16162224IPR001356Homeobox domain
PfamPF000464.7E-16164218IPR001356Homeobox domain
CDDcd000861.23E-16164221No hitNo description
Gene3DG3DSA:1.10.10.601.5E-17164218IPR009057Homeodomain-like
PROSITE patternPS000270195218IPR017970Homeobox, conserved site
SMARTSM003402.8E-25220263IPR003106Leucine zipper, homeobox-associated
PfamPF021836.2E-10220254IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MMGLDQDASS NSGLHLILGL ALTATTTTTP SLPSISNKLD HVDHHHHLIT LRPTTKSPYN  60
SSEAEPSLTL GLSRESYLKV PKNIIGQNSN NKVSSCDDPL DHLSTQTNSP HHSAVSSFSS  120
GRVKRERDLS CEEVVDATEI DQRDHSCEGI VRATDEDEDG TAARKKLRLS KEQSALLEES  180
FKQHSTLNPK QKQALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEFLK KCCETLTDEN  240
RRLQKELQEL KALKLAQPLY MPMPAATLTM CPSCERLGGG INGGGGGSPK TPFSMAPKPH  300
FFNPFANPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212220RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.19290.0cotyledon| epicotyl| flower| hypocotyl| leaf| meristem| root| seed coat| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G157600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311730.0KT031173.1 Glycine max clone HN_CCL_18 homeodomain/HOMEOBOX transcription factor (Glyma17g16930.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304594.10.0homeobox-leucine zipper protein HAT22
RefseqXP_028211329.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-89HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0K2CTB00.0A0A0K2CTB0_SOYBN; Homeodomain/HOMEOBOX transcription factor
TrEMBLA0A445G7C00.0A0A445G7C0_GLYSO; Homeobox-leucine zipper protein HAT22
STRINGGLYMA17G16930.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-78HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]