PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G146600.1.p
Common NameGLYMA_17G146600, LOC100775750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GATA
Protein Properties Length: 545aa    MW: 60310.6 Da    PI: 7.041
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G146600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.94.3e-16741135
                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                         C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Glyma.17G146600.1.p  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                         ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.3E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.38E-11546No hitNo description
CDDcd002029.48E-17654No hitNo description
Gene3DG3DSA:3.30.50.102.3E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF003207.1E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.7E-8287380IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG TLANYTPLHA RAENIDYEDQ  60
KVSRVKSISL NKNTEVKLVK RKQNYGNAAS GGFVPDYSQG YRKVVDEDTS NRSSSGSAVS  120
NSESCAQFGG PDASDLTGPA QSVVWDAMVP SKKRTCAGRP KPSSVEKLTR DLCTILHEQQ  180
SYFSASSEED LLFESDTPMV SVEIGHGSIL IRHPSSIARD EESEASSLSV DNKQCLMNEA  240
YSFSSTIPIY SDRSSMNFSS HGVEKIKNSA GQIMQQEKLE RDKSQLEKLQ VHGNHDSPLC  300
SIDLNDVVNY EEFMRNLTNE QQQQLLKYLP VVDTAKFPDS LRNMFNSFQF KENLIYFQQL  360
LGEGVFNISL LGAKPEEWKT LERLALSNLS KSKWVEHYNF LKKCENKSGK SIGLGSTAME  420
SSNVTTGKRM REHDSRNQNI PELKTTMRSP KRVIIKPPSC EVKEVVEEGS SFSPKSLFAL  480
PHGVGGLHML DSFNFVGESS EDLLLEVPSN SSFPQAELLH PSLSYGARQV STTSSSVHSP  540
VTHP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G146600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-175AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549942.10.0GATA transcription factor 26
RefseqXP_028210830.10.0GATA transcription factor 26-like
SwissprotQ8W4H11e-150GAT26_ARATH; GATA transcription factor 26
TrEMBLA0A445G6U80.0A0A445G6U8_GLYSO; GATA transcription factor 26
TrEMBLI1MV650.0I1MV65_SOYBN; Uncharacterized protein
STRINGGLYMA17G15610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44243155
Representative plantOGRP27491530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-152GATA transcription factor 26