PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G127500.1.p
Common NameGLYMA_17G127500, LOC100813548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 515aa    MW: 57804.1 Da    PI: 6.4529
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G127500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.43.1e-1111415131374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalklfse 86 
                          lv+lL++cAeav+ +d++ a+ lL++l+ +a   g+++qR+a++f+++L +rl+   + + +a p+ + + +     s+e   a++l +e
  Glyma.17G127500.1.p 141 LVQLLIACAEAVACRDKSHASILLSELKANALVFGSSFQRVASCFVQGLTERLNL-IQPIGSAGPMMAPAMNImdaaSDEMEEAYRLVYE 229
                          689**************************************************98.667777666665553335577999999******* PP

                 GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakfAe 170
                          ++P ++f+h +aN+++lea+ege+ vH++D+++s    +G QW aL+q+La+R++g    +lRiTgvg        +l+++ge L+ +A+
  Glyma.17G127500.1.p 230 LCPHIQFGHYLANSTVLEAFEGESFVHVVDLGMSlglrHGHQWRALIQSLANRASGERvrRLRITGVGL-----CVRLQTIGEELSVYAN 314
                          ******************************98753333788*************665444*********.....88************** PP

                 GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                          +lg+++ef+v v k+le+l++e+++v+++E+l+Vn++lqlh +++es    +   +vL+++ +l Pkv+v+veq+++hn++ Fl rf+e+
  Glyma.17G127500.1.p 315 NLGINLEFSV-VNKNLENLKPEDIEVREEEVLVVNSILQLHCVVKESRGALN---SVLQMIHGLGPKVLVMVEQDSSHNGPFFLGRFMES 400
                          *********9.7********************************88877777...8********************************** PP

                 GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                          l+yys++fdsl++ lp+ + +r+k+E++++++ei+n+v+ceg  r erhe++ +Wr+r+++aGF+++p++  a+++  ll +kv  +gy+
  Glyma.17G127500.1.p 401 LHYYSSIFDSLDVMLPKYDTKRAKMEQFYFAEEIKNIVSCEGPLRMERHERVDQWRRRMSRAGFQAAPIKMVAQSKQWLLKNKV-CEGYT 489
                          *********************************************************************987766655554444.6**** PP

                 GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                          v ee+g+lv+gWk+rp+v+vS+W+
  Glyma.17G127500.1.p 490 VVEEKGCLVFGWKSRPIVAVSCWK 513
                          ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.038115494IPR005202Transcription factor GRAS
PfamPF035141.1E-108141513IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MAPLYSAFNG EIDGENLPLA FDIWATNLWA YGYYPHQPAI SENSSSKLVD FPFCDGTIIR  60
DNKRVKRTVC FPIYNSVSCH SFFNTNSSSR NSIPKLHFRD HIRTYTQRYL AAEPVEEASE  120
DTNSSESSGG EEDGCADGVR LVQLLIACAE AVACRDKSHA SILLSELKAN ALVFGSSFQR  180
VASCFVQGLT ERLNLIQPIG SAGPMMAPAM NIMDAASDEM EEAYRLVYEL CPHIQFGHYL  240
ANSTVLEAFE GESFVHVVDL GMSLGLRHGH QWRALIQSLA NRASGERVRR LRITGVGLCV  300
RLQTIGEELS VYANNLGINL EFSVVNKNLE NLKPEDIEVR EEEVLVVNSI LQLHCVVKES  360
RGALNSVLQM IHGLGPKVLV MVEQDSSHNG PFFLGRFMES LHYYSSIFDS LDVMLPKYDT  420
KRAKMEQFYF AEEIKNIVSC EGPLRMERHE RVDQWRRRMS RAGFQAAPIK MVAQSKQWLL  480
KNKVCEGYTV VEEKGCLVFG WKSRPIVAVS CWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-511415134375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550863.10.0PREDICTED: scarecrow-like protein 21
TrEMBLI1MUM20.0I1MUM2_SOYBN; Uncharacterized protein
STRINGGLYMA17G13680.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70521119
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-76RGA-like 1