PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G119600.1.p
Common NameGLYMA_17G119600, LOC100797015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 453aa    MW: 49576.7 Da    PI: 7.9428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G119600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-32249304156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Glyma.17G119600.1.p 249 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 304
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355246306IPR017930Myb domain
SuperFamilySSF466898.36E-17246307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28247307IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26249304IPR006447Myb domain, plants
PfamPF002497.9E-7251302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MESPSELSLD CKPQSYSLLL KSFGDQTDQT YKLEEFLSRL EEERLKIDAF KRELPLCMQL  60
LTNAMEASRQ QLQAYKVNHG TKPVLEEFIP MKHLASDQSS EKATNMSDKA NWMTSAQLWS  120
QASEGTKQQP TITTPKESDI GFSISPKLAL DNKQRNGGGA FLPFSKERNS CQGSTLRPLP  180
ELALAYAEKE MEDKKLRPEV EIKGVSCQSK KENSGSDGTV VDQGKGGSPV ASSHATTTTT  240
TSSAQTHRKA RRCWSPDLHR RFVNALQMLG GSQVATPKQI RELMKVDGLT NDEVKSHLQK  300
YRLHTRRPSP SPQAVGAAPQ LVVLGGIWVP PEYATAAHTA TPTLYGAHPT SHAPPPHYCA  360
ATPMPQDFYT TAPPQPLLPP PPPHHNALHH LHMYKAAPHG QGSPESDVPS NGERSESIED  420
GKSESSSWKG ENEGERKGIS KGSNGSEITL KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14249302154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14249302154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14249302154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14249302154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.449120.0meristem| root
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}.
UniprotTISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G119600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550834.10.0myb family transcription factor EFM
RefseqXP_028210005.10.0myb family transcription factor EFM-like
SwissprotQ9ZQ851e-128EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A445G5N40.0A0A445G5N4_GLYSO; Myb family transcription factor EFM
TrEMBLI1MUC80.0I1MUC8_SOYBN; Uncharacterized protein
STRINGGLYMA17G12720.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-118G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]