PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G100400.1.p
Common NameGLYMA_17G100400, LOC100810700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 278aa    MW: 32117.1 Da    PI: 4.9349
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G100400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.43.8e-25146194452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++s +++s+yF++pi +AA eL+v+ T+LK++CR+ GI+RWPhRk+ sl
  Glyma.17G100400.1.p 146 TLSRKTISQYFYMPISQAATELNVGITLLKKRCREVGIRRWPHRKLMSL 194
                          7899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.859126214IPR003035RWP-RK domain
PfamPF020429.6E-21147194IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MESQSLMGWS SFYEIDEKPF PFTCQFSYSG NSEVYPSLDW PYGFPIQDYY LDAVPLMDYY  60
PSDPLYETLT LATTEPTQSV QDYDFYDIKK GLSGWNEVDA VFDSQKVFLF GNNEESGGIE  120
KQMMEEDGKV NNQGREERIN NSSCRTLSRK TISQYFYMPI SQAATELNVG ITLLKKRCRE  180
VGIRRWPHRK LMSLQTLINN VQELGKEEGG ESEEKLRSAI EILEREKKVL EEMPDTELED  240
TTKRLRQACF KANYKKRKLT VTGRRKEPRS SSSSSLH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G100400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352460.0AC235246.1 Glycine max strain Williams 82 clone GM_WBb0033G13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550783.10.0protein RKD1
RefseqXP_028210682.10.0protein RKD1-like
TrEMBLK7MKW50.0K7MKW5_SOYBN; Uncharacterized protein
STRINGGLYMA17G10866.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-47RWP-RK domain-containing protein