PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G089300.1.p
Common NameGLYMA_17G089300, LOC100783782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 331aa    MW: 36482 Da    PI: 7.476
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G089300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.2e-3953113262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +e++lkcprC+st+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Glyma.17G089300.1.p  53 QEQSLKCPRCESTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 113
                          57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2747107IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99457111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGFSSLHVCM DSSNHWMQGI IHEECGGVDS SSPSGDMLPC SRPMTERRLR PPQEQSLKCP  60
RCESTHTKFC YYNNYSLTQP RYFCKTCRRY WTKGGTLRNI PVGGGCRKNK KVSTKKIIND  120
QHQPAISTQN QVHHPGPSYL HNHKDLQLPY LDVQFSHLNN LLGTNAGALG NPTFMESKYN  180
MGMLENPRPI DFMESRLDGM NMIRGSTRSF ELLENSDMTV GFGDVSGYNG SPLNYQAISS  240
SAFGGMSLDG NISNVGTYIM DSCQRLMLPY DGGDNTLNGS IDVKPNPKLL SLEWQDHQGC  300
SGAEKVSLGY LDGSGSSWTG YGSSTTNPLV *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G089300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283290.0EU028329.1 Glycine max clone BAC gmw1-24M16 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549622.10.0dof zinc finger protein DOF5.6 isoform X1
RefseqXP_028209952.10.0dof zinc finger protein DOF5.6-like isoform X1
TrEMBLA0A445G4940.0A0A445G494_GLYSO; Dof zinc finger protein DOF5.6 isoform A
TrEMBLK7MKQ30.0K7MKQ3_SOYBN; Uncharacterized protein
STRINGGLYMA17G09710.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-49Dof family protein