PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G081800.1.p
Common NameGLYMA_17G081800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 301aa    MW: 32708.6 Da    PI: 7.0889
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G081800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-392989262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+ss
  Glyma.17G081800.1.p 29 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSS 89
                         6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-333187IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-273187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.733387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MQQIHSMPGG RFFSGSGSAD RRLRPHHQNQ QALKCPRCDS LNTKFCYYNN YNLSQPRHFC  60
KNCRRYWTKG GVLRNVPVGG GCRKSKRSSK PNKITPSETA SPPPPPHPDH NNNSNSHSSS  120
ESSSLTAAAA TTTEAVSAPE TLNSDSNNNN NMQESKLLIP ALETNNSLEQ GTGDCGGIFS  180
EIGPFTSLIT TTTSTNEPLG SGFGFGNSTL PDASSFQWHY QKVSSNNEEL KLPENSFLDH  240
TVDLSGMHSK TSHGGGFGSL DWQGGADQGL FDLPNTVDHA YWSHTHWSDH DNSSSLFHLP  300
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.258960.0leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G081800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572540.0DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236530.20.0Dof4
TrEMBLI1MT950.0I1MT95_SOYBN; Uncharacterized protein
STRINGGLYMA17G08950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-39OBF binding protein 4